Melanocortin-5 R/MC5R Antibody - BSA Free

Immunohistochemistry-Paraffin: Melanocortin-5 R/MC5R Antibody [NBP2-14224] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry: Melanocortin-5 R/MC5R Antibody [NBP2-14224] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Melanocortin-5 R/MC5R Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MC5R
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Melanocortin-5 R/MC5R Protein (NBP2-14224PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Melanocortin-5 R/MC5R Antibody - BSA Free

• MC2
• MC-2
• MC5
• MC5R
• MC5-R
• melanocortin 5 receptor
• melanocortin receptor 5
• Melanocortin-5 R
• melanocortin-5 receptor
• Melanocortin5R
• Melanocortin-5R

Background

MC5R, a Melanocortin Receptor, mediates the effects of melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH), and activates adenylate cyclase. This receptor controls multiple functions in the brain and in peripheral tissues, such as thermoregulation, immunomodulation, appetite control, and sexual behavior. Melanocortin 5 receptor has been reported to be expressed in a variety of tissues, especially in pituitary, exocrine glands, reproductive organs, lung, kidney, and esophagus. No human ESTs have been isolated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MC5R