Melanocortin-5 R/MC5R Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDM |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MC5R |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Melanocortin-5 R/MC5R Antibody - BSA Free
Background
MC5R, a Melanocortin Receptor, mediates the effects of melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH), and activates adenylate cyclase. This receptor controls multiple functions in the brain and in peripheral tissues, such as thermoregulation, immunomodulation, appetite control, and sexual behavior. Melanocortin 5 receptor has been reported to be expressed in a variety of tissues, especially in pituitary, exocrine glands, reproductive organs, lung, kidney, and esophagus. No human ESTs have been isolated.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for Melanocortin-5 R/MC5R Antibody (NBP2-14224) (0)
There are no publications for Melanocortin-5 R/MC5R Antibody (NBP2-14224).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Melanocortin-5 R/MC5R Antibody (NBP2-14224) (0)
There are no reviews for Melanocortin-5 R/MC5R Antibody (NBP2-14224).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Melanocortin-5 R/MC5R Antibody (NBP2-14224) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Melanocortin-5 R/MC5R Products
Research Areas for Melanocortin-5 R/MC5R Antibody (NBP2-14224)
Find related products by research area.
|
Blogs on Melanocortin-5 R/MC5R