Melanocortin-2 R/MC2R Antibody

Western Blot: Melanocortin-2 R/MC2R Antibody [NBP2-84158] - WB Suggested Anti-MC2R Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Product Discontinued

Melanocortin-2 R/MC2R Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Melanocortin-2 R/MC2R. Peptide sequence: LRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MC2R
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Melanocortin-2 R/MC2R Antibody

• ACTH receptor
• ACTHR
• ACTH-R
• ACTHRcorticotropin receptor
• adrenocorticotropic hormone receptor
• Adrenocorticotropin receptor
• MC2 receptor
• MC2R
• MC2-R
• melanocortin 2 receptor (adrenocorticotropic hormone)
• Melanocortin receptor 2
• Melanocortin-2 R
• Melanocortin2R
• Melanocortin-2R
• MGC125798

Background

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MC2R