MEL-18 Antibody - BSA Free

Immunohistochemistry-Paraffin: MEL-18 Antibody [NBP2-13739] Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MEL-18 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MEL-18 Antibody - BSA Free (NBP2-13739) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCGF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MEL-18 Protein (NBP2-13739PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MEL-18 Antibody - BSA Free

• MEL-18
• polycomb group ring finger 2
• polycomb group RING finger protein 2
• RING finger protein 110DNA-binding protein Mel-18
• RNF110MEL18
• Zinc finger protein 144
• ZNF144MGC10545

Background

MEL-18 is a transcriptional repressor that binds specifically to the DNA sequence 5'-GACTNGACT-3'. Mel18 has tumor suppressor activity and may play a role in cell proliferation and/or neural cell development. It regulates proliferation of early T progenitor cells by maintaining expression of HES1. Also plays a role in antero-posterior specification of the axial skeleton and negative regulation of the self-renewal activity of hematopoietic stem cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCGF2