MEL-18 Antibody

Images

 
Immunohistochemistry-Paraffin: MEL-18 Antibody [NBP2-13739] Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEL-18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCGF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MEL-18 Protein (NBP2-13739PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEL-18 Antibody

  • MEL-18
  • polycomb group ring finger 2
  • polycomb group RING finger protein 2
  • RING finger protein 110DNA-binding protein Mel-18
  • RNF110MEL18
  • Zinc finger protein 144
  • ZNF144MGC10545

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00084108-M01
Species: Hu
Applications: ELISA, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MEL-18 Antibody (NBP2-13739) (0)

There are no publications for MEL-18 Antibody (NBP2-13739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEL-18 Antibody (NBP2-13739) (0)

There are no reviews for MEL-18 Antibody (NBP2-13739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MEL-18 Antibody (NBP2-13739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEL-18 Products

Bioinformatics Tool for MEL-18 Antibody (NBP2-13739)

Discover related pathways, diseases and genes to MEL-18 Antibody (NBP2-13739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEL-18 Antibody (NBP2-13739)

Discover more about diseases related to MEL-18 Antibody (NBP2-13739).
 

Pathways for MEL-18 Antibody (NBP2-13739)

View related products by pathway.

PTMs for MEL-18 Antibody (NBP2-13739)

Learn more about PTMs related to MEL-18 Antibody (NBP2-13739).
 

Research Areas for MEL-18 Antibody (NBP2-13739)

Find related products by research area.

Blogs on MEL-18

There are no specific blogs for MEL-18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEL-18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCGF2