Meis homeobox 3 Antibody - Azide and BSA Free

Western Blot: Meis homeobox 3 Antibody [NBP3-16055] - Western blot analysis of extracts of various cell lines, using Meis homeobox 3 antibody (NBP3-16055) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Meis homeobox 3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Meis homeobox 3 Antibody - Azide and BSA Free (NBP3-16055) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 325-375 of human Meis homeobox 3 (NP_001287988.1). IDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MEIS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Meis homeobox 3 Antibody - Azide and BSA Free

• DKFZp547H236
• Meis homeobox 3
• Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse)
• Meis1, myeloid ecotropic viral integration site 1 homolog 3
• Meis1-related protein 2
• MRG2homeobox protein Meis3

Background

MEIS3, also known as Homeobox protein Meis3, has 3 isoforms, a 375 amino acid isoform that is 41 kDa, a 421 amino acid isoform that is 46 kDa, and a 358 amino acid isoform that is 39 kDa, and is nucleus located. Little is currently known about its function. Studies are performed on the relationship of this protein to neuronitis. MEIS3 protein involvement has been observed with relation to HOXA13 in the regulation of transcription, DNA-dependent, negative regulation of apoptotic process, and positive regulation of protein kinase B signaling cascade pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MEIS3