MED4 Antibody (8T5C9)

Western Blot: MED4 Antibody (8T5C9) [NBP3-15287] - Western blot analysis of extracts of various cell lines, using MED4 antibody (NBP3-15287) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry-Paraffin: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry of paraffin-embedded rat liver using MED4 Rabbit mAb (NBP3-15287) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry of paraffin-embedded human colon carcinoma using MED4 Rabbit mAb (NBP3-15287) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry of paraffin-embedded mouse lung using MED4 Rabbit mAb (NBP3-15287) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry analysis of MED4 in paraffin-embedded rat colon tissue using MED4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry analysis of MED4 in paraffin-embedded human breast tissue using MED4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry analysis of MED4 in paraffin-embedded human colon tissue using MED4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry analysis of MED4 in paraffin-embedded mouse colon tissue using MED4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry analysis of MED4 in paraffin-embedded human esophagus tissue using MED4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: MED4 Antibody (8T5C9) [NBP3-15287] - Immunohistochemistry analysis of MED4 in paraffin-embedded human breast cancer tissue using MED4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 8T5C9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MED4 Antibody (8T5C9) Summary

• Description: Novus Biologicals Rabbit MED4 Antibody (8T5C9) (NBP3-15287) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human MED4 (Q9NPJ6). KYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MED4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MED4 Antibody (8T5C9)

• Activator-recruited cofactor 36 kDa component
• ARC36
• DRIP36
• DRIP36mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae)
• FLJ10956
• HSPC126
• HSPC126vitamin D receptor interacting protein
• MED4
• mediator complex subunit 4TRAP/SMCC/PC2 subunit p36 subunit
• subunit 4 homolog
• TRAP36
• VDRIP

Background

MED4 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymera

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED4