MED27 Antibody (8B8) - Azide and BSA Free

Western Blot: MED27 Antibody (8B8) [H00009442-M01] - CRSP8 monoclonal antibody (M01), clone 8B8 Analysis of CRSP8 expression in Hela S3 NE.

Immunohistochemistry-Paraffin: MED27 Antibody (8B8) [H00009442-M01] - Analysis of monoclonal antibody to CRSP8 on formalin-fixed paraffin-embedded human colon. Antibody concentration 0.3 ug/ml.

Western Blot: MED27 Antibody (8B8) [H00009442-M01] - Analysis of CRSP8 expression in transfected 293T cell line by CRSP8 monoclonal antibody (M01), clone 8B8.Lane 1: CRSP8 transfected lysate(35.4 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: MED27 Antibody (8B8) [H00009442-M01] - Detection limit for recombinant GST tagged MED27 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 8B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MED27 Antibody (8B8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MED27 Antibody (8B8) - Azide and BSA Free (H00009442-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
• Specificity: CRSP8 - cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MED27
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MED27 Antibody (8B8) - Azide and BSA Free

• cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa
• CRSP34CRSP complex subunit 8
• CRSP8CRAP34
• mediator complex subunit 27Transcriptional coactivator CRSP34
• mediator of RNA polymerase II transcription subunit 27
• MGC11274
• P37 TRAP/SMCC/PC2 subunit
• subunit 8 (34kD)
• TRAP37

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED27
• Entrez:
  • 9442(Human)
• OMIM:
  • 605044(Human)
• Uniprot:
  • AAH02878(Human)