MED25 Antibody

Images

 
Western Blot: MED25 Antibody [NBP2-83188] - WB Suggested Anti-MED25 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart
Chromatin Immunoprecipitation: MED25 Antibody [NBP2-83188] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, ZeSpecies Glossary
Applications WB, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED25 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human MED25. Peptide sequence: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Zebrafish (100%), Canine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
MED25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Chromatin Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED25 Antibody

  • ACID1
  • Activator Interaction Domain-Containing Protein 1
  • Activator-Recruited Cofactor 92 KDa Component
  • ARC/Mediator Transcriptional Coactivator Subunit
  • ARC92
  • BVSYS
  • CMT2B2
  • Mediator Complex Subunit 25
  • Mediator Of RNA Polymerase II Transcription Subunit 25
  • Mediator Of RNA Polymerase II Transcription, Subunit 25 Homolog (S. Cerevisiae)
  • Mediator Of RNA Polymerase II Transcription, Subunit 25 Homolog
  • P78
  • TCBAP0758

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-337
Species: Hu, Mu
Applications: WB (-), ChIP, IP
H00010445-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF009
Species: Hu
Applications: WB, IHC
NBP1-79384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP2-92972
Species: Hu, Mu, Rt
Applications: WB, IP, KO
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IHC-Fr (-), KD
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-45780
Species: Hu
Applications: WB, IHC
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46853
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-83188
Species: Hu, Mu, Rt, Po, Bv, Ca, Ze
Applications: WB, ChIP

Publications for MED25 Antibody (NBP2-83188) (0)

There are no publications for MED25 Antibody (NBP2-83188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED25 Antibody (NBP2-83188) (0)

There are no reviews for MED25 Antibody (NBP2-83188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for MED25 Antibody (NBP2-83188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED25 Products

Array NBP2-83188

Bioinformatics Tool for MED25 Antibody (NBP2-83188)

Discover related pathways, diseases and genes to MED25 Antibody (NBP2-83188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED25 Antibody (NBP2-83188)

Discover more about diseases related to MED25 Antibody (NBP2-83188).
 

Pathways for MED25 Antibody (NBP2-83188)

View related products by pathway.

PTMs for MED25 Antibody (NBP2-83188)

Learn more about PTMs related to MED25 Antibody (NBP2-83188).

Blogs on MED25

There are no specific blogs for MED25, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED25