Recombinant Human MED24 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MED24 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human THRAP4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSC

Protein/Peptide Type
Partial Recombinant Protein
Gene
MED24

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MED24 Protein

  • cofactor required for Sp1 transcriptional activation, subunit 4, 100kDa
  • CRSP100
  • DRIP100CRSP complex subunit 4
  • hTRAP100
  • KIAA0130CRSP4
  • mediator complex subunit 24ARC100
  • MGC8748
  • subunit 24 homolog
  • thyroid hormone receptor associated protein 4
  • Thyroid hormone receptor-associated protein 4
  • Thyroid hormone receptor-associated protein complex 100 kDa component
  • Trap100
  • TRAP100THRAP4
  • Vitamin D3 receptor-interacting protein complex 100 kDa component
  • vitamin D3 receptor-interacting protein complex component DRIP100

Background

THRAP4 - thyroid hormone receptor associated protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP2-24393
Species: Hu
Applications: WB
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP1-84377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00009862-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MED24 Partial Recombinant Protein (H00009862-Q01) (0)

There are no publications for MED24 Partial Recombinant Protein (H00009862-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED24 Partial Recombinant Protein (H00009862-Q01) (0)

There are no reviews for MED24 Partial Recombinant Protein (H00009862-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED24 Partial Recombinant Protein (H00009862-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED24 Products

Bioinformatics Tool for MED24 Partial Recombinant Protein (H00009862-Q01)

Discover related pathways, diseases and genes to MED24 Partial Recombinant Protein (H00009862-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED24 Partial Recombinant Protein (H00009862-Q01)

Discover more about diseases related to MED24 Partial Recombinant Protein (H00009862-Q01).
 

Pathways for MED24 Partial Recombinant Protein (H00009862-Q01)

View related products by pathway.

PTMs for MED24 Partial Recombinant Protein (H00009862-Q01)

Learn more about PTMs related to MED24 Partial Recombinant Protein (H00009862-Q01).

Blogs on MED24

There are no specific blogs for MED24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MED24 Antibody
NB100-74599

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MED24 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED24