MED21 Antibody (5A6)

Images

 
Western Blot: MED21 Antibody (5A6) [H00009412-M04] - Analysis of SURB7 expression in HeLa (Cat # L013V1).
Immunocytochemistry/ Immunofluorescence: MED21 Antibody (5A6) [H00009412-M04] - Analysis of monoclonal antibody to SURB7 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: MED21 Antibody (5A6) [H00009412-M04] - Detection limit for recombinant GST tagged SURB7 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MED21 Antibody (5A6) Summary

Immunogen
SURB7 (AAH08380, 1 a.a. ~ 145 a.a) full length recombinant protein with GST tag.MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAI NKDQPANPTEEYAQLFAALIARTAKDIDVLIDSLPSEESTAA LQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIA QSQLKTRSGTHSQSLPDS
Specificity
SURB7 - SRB7 suppressor of RNA polymerase B homolog (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MED21
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MED21 Antibody (5A6)

  • hSrb7
  • mediator complex subunit 21SRB7 (suppressor of RNA polymerase B, yeast) homolog
  • RNA polymerase II complex component SRB7
  • RNA polymerase II holoenzyme component SRB7
  • RNAPII complex component SRB7
  • SRB7 suppressor of RNA polymerase B homolog
  • SRB7SRB7 suppressor of RNA polymerase B homolog (yeast)
  • SURB7mediator of RNA polymerase II transcription subunit 21

Background

Surb7 / MED21 is a member of the mediator complex that can act as both a positive and negative regulator of transcription. The mediator complex interacts with RNA pol II and its associated proteins, the general transcription factors. Mediator proteins serve as a bridge connecting the activator and basal transcription machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009443-M01
Species: Hu
Applications: WB, ELISA
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBL1-11392
Species: Hu
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
AF5089
Species: Hu
Applications: WB, IHC
NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA

Publications for MED21 Antibody (H00009412-M04) (0)

There are no publications for MED21 Antibody (H00009412-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED21 Antibody (H00009412-M04) (0)

There are no reviews for MED21 Antibody (H00009412-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED21 Antibody (H00009412-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED21 Products

Bioinformatics Tool for MED21 Antibody (H00009412-M04)

Discover related pathways, diseases and genes to MED21 Antibody (H00009412-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED21 Antibody (H00009412-M04)

Discover more about diseases related to MED21 Antibody (H00009412-M04).
 

Pathways for MED21 Antibody (H00009412-M04)

View related products by pathway.

PTMs for MED21 Antibody (H00009412-M04)

Learn more about PTMs related to MED21 Antibody (H00009412-M04).

Blogs on MED21

There are no specific blogs for MED21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED21 Antibody (5A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MED21
Entrez
OMIM
Uniprot