Home » MED19 » MED19 Antibodies » MED19 Antibody

MED19 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MED19 Antibody [NBP1-81319] - Analysis in human cell line TD47D.
Western Blot: MED19 Antibody [NBP1-81319] - Analysis in human cell line TD47D.
Immunocytochemistry/ Immunofluorescence: MED19 Antibody [NBP1-81319] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MED19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED19 Protein (NBP1-81319PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED19 Antibody

  • LCMR1mediator of RNA polymerase II transcription subunit 19
  • Lung cancer metastasis-related protein 1
  • mediator complex subunit 19DT2P1G7
  • mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 19 homolog

Background

MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activatetranscription via RNA polymerase II (Sato et al., 2003 (PubMed 12584197)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MED10 Antibody
NBP3-13045
Western Blot: MED10 Antibody [NBP3-13045] - 293T whole cell and nuclear extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with MED10 antibody (NBP3-13045) diluted at 1:500.
Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP3-13045] - MED10 antibody detects MED10 protein at nucleus by immunofluorescent analysis. Sample: 293T cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: MED10 protein stained by MED10 antibody (NBP3-13045) diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu
Applications: ICC/IF, WB
MED26 Antibody
NBP2-62629
Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629] - Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MED26 antibody. Corresponding MED26 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: MED26 Antibody [NBP2-62629] - Staining of human testis shows high expression.
Species: Hu
Applications: IHC, IHC-P
CDC2L6 Antibody
NBP2-86684
Immunocytochemistry/Immunofluorescence: CDC2L6 Antibody [NBP2-86684] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing vesicle and weak nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: CDC2L6 Antibody [NBP2-86684] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
THRAP2 Antibody
NBP1-89612
Immunohistochemistry-Paraffin: THRAP2 Antibody [NBP1-89612] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: THRAP2 Antibody [NBP1-89612] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MED9 Antibody
NBP2-31639
Immunohistochemistry: MED9 Antibody [NBP2-31639] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: MED9 Antibody [NBP2-31639] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NRSF Antibody
NB100-757
Immunohistochemistry-Paraffin: NRSF Antibody [NB100-757] - FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- REST used at a dilution of 1:1,000 (1ug/ml). Detection: DAB Counterstain: IHC Hematoxylin (blue).
Western Blot: NRSF Antibody [NB100-757] - Detection of Human REST by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-REST antibody NB100-757 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(1 Publication)
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
MED21 Antibody
(PCRP-MED21-4B5)
NBP3-13814
Flow Cytometry: MED21 Antibody (PCRP-MED21-4B5) [NBP3-13814] - Flow cytometric analysis of PFA-fixed HeLa cells. MED21 antibody (PCRP-MED21-4B5) followed by goat anti-mouse IgG-CF488 (blue); unstained cells (red).
Flow Cytometry: MED21 Antibody (PCRP-MED21-4B5) [NBP3-13814] - Flow cytometric analysis of PFA-fixed U87 cells. MED21 antibody (PCRP-MED21-4B5) followed by goat anti-mouse IgG-CF488 (blue); unstained cells (red).
Immunocytochemistry/Immunofluorescence: MED21 Antibody (PCRP-MED21-4B5) [NBP3-13814] - Immunofluorescence Analysis of PFA-fixed HeLa cells stained using MED21 Antibody (PCRP-MED21-4B5) followed by goat anti-mouse IgG-CF488. Membrane stained with phalloidin.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
MED7 Antibody (3E7)
H00009443-M01
Western Blot: MED7 Antibody (3E7) [H00009443-M01] - Analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi ( Cat # H00009443-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody (M01), clone 3E7 (Cat # H00009443-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: MED7 Antibody (3E7) [H00009443-M01] - Detection limit for recombinant GST tagged CRSP9 is approximately 0.3ng/ml as a capture antibody.
Western Blot: MED7 Antibody (3E7) [H00009443-M01] - Analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody (M01), clone 3E7.Lane 1: CRSP9 transfected lysate(27.2 KDa).Lane 2: Non-transfected lysate.
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Nav1.6 Antibody
NBP2-84177
Immunohistochemistry-Paraffin: Nav1.6 Antibody [NBP2-84177] - Rabbit Anti-SCN8A Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Immunohistochemistry-Paraffin: Nav1.6 Antibody [NBP2-84177] - Rabbit Anti-SCN8A Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult liver. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Western Blot: Nav1.6 Antibody [NBP2-84177] - WB Suggested Anti-SCN8A antibody Titration: 1 ug/mL. Sample Type: Human heart
Species: Hu
Applications: IHC, IHC-P, WB
MED15 Antibody
(OTI1C11)
NBP2-45780
Immunohistochemistry: MED15 Antibody (1C11) [NBP2-45780] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: MED15 Antibody (1C11) [NBP2-45780] - Analysis of Human liver tissue.(Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: MED15 Antibody (1C11) [NBP2-45780] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, IHC-P, WB
MED29 Antibody
H00055588-B01P
Western Blot: MED29 Antibody [H00055588-B01P] - Analysis of MED29 expression in transfected 293T cell line by MED29 polyclonal antibody. Lane 1: MED29 transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MED29 Antibody [H00055588-B01P] - Analysis of purified antibody to MED29 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB
CDC2L2 Antibody
NB100-496
Immunohistochemistry-Paraffin: CDC2L2 Antibody [NB100-496] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-CDK11 (NB100-496). Detection: DAB
Immunoprecipitation: CDC2L2 Antibody [NB100-496] - Detection of human CDK11 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CDK11 antibody NB100-496 (lot NB100-496-3) used for IP at 3 ug per reaction. CDK11 was also immunoprecipitated by a previous lot of this antibody (lot NB100-496-2). For blotting immunoprecipitated CDK11, NB100-496 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: CDC2L2 Antibody [NB100-496] - Whole cell lysate (15 ug) from HeLa and HEK293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CDK11 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu
Applications: IHC, IHC-P, IP, WB
MED6 Antibody
H00010001-D01P
Western Blot: MED6 Antibody [H00010001-D01P] - Analysis of MED6 expression in HepG2.
Western Blot: MED6 Antibody [H00010001-D01P] - Analysis of MED6 expression in transfected 293T cell line by MED6 polyclonal antibody.Lane 1: MED6 transfected lysate(28.40 KDa).Lane 2: Non-transfected lysate.
Western Blot: MED6 Antibody [H00010001-D01P] - Analysis of MED6 expression in mouse liver.
Species: Hu, Mu
Applications: WB

COMP/Thrombospondin-5
DCMP0
(11 Publications)
Species: Hu
Applications: ELISA
MED28 Antibody
NBP1-85104
Immunohistochemistry-Paraffin: MED28 Antibody [NBP1-85104] - Staining of human placenta shows nuclear positivity in trophoblastic cells.
Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Recombinant Human
COL9A3 GST (N-Term) P ...
H00001299-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
COL9A1 Antibody
NBP2-99960
Immunohistochemistry-Paraffin: COL9A1 Antibody [NBP2-99960] - Immunochemical staining of human COL9A1 in human breast carcinoma with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
MED14 Antibody
NBP2-83187
Western Blot: MED14 Antibody [NBP2-83187] - WB Suggested Anti-MED14 Antibody Titration: 0.2-1 ug/ml. Positive Control: A549 cell lysateMED14 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells
Chromatin Immunoprecipitation: MED14 Antibody [NBP2-83187] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Species: Hu
Applications: ChIP, WB
CDC2L1 Antibody
NBP2-92609
Western Blot: CDC2L1 Antibody [NBP2-92609] - Analysis of extracts of various cell lines, using CDC2L1 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: CDC2L1 Antibody [NBP2-92609] - Analysis of HeLa cells using CDC2L1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu
Applications: ICC/IF, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
Western Blot: Bax Antibody (6A7) [NBP1-28566] - rOPN administration elevated the expression of autophagy-related proteins while suppressing apoptosis in rat brain at 24 h after SAH. The effects of rOPN on expression levels of Bax, mean +/- SD is 1.006 +/- 0.321 in Sham group, 37.47 +/- 10.86 in SAH + Vehicle group, 23.83 +/- 8.143 in SAH + rOPN group, F = 33.13, in the left hemisphere of rat brain at 24 h after SAH. Sample size is 18, n = 6 per group. Data were presented as mean +/- SD. *P < .05, ***P < .001 vs Sham group; #P < .05, ##P < .01 vs SAH + Vehicle group Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/cns.13199) licensed under a CC-BY licence.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment. IHC-F image submitted by a verified customer review
(3 Reviews)
(18 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB

Publications for MED19 Antibody (NBP1-81319) (0)

There are no publications for MED19 Antibody (NBP1-81319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED19 Antibody (NBP1-81319) (0)

There are no reviews for MED19 Antibody (NBP1-81319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED19 Antibody (NBP1-81319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED19 Products

Bioinformatics Tool for MED19 Antibody (NBP1-81319)

Discover related pathways, diseases and genes to MED19 Antibody (NBP1-81319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED19 Antibody (NBP1-81319)

Discover more about diseases related to MED19 Antibody (NBP1-81319).
 

Pathways for MED19 Antibody (NBP1-81319)

View related products by pathway.

PTMs for MED19 Antibody (NBP1-81319)

Learn more about PTMs related to MED19 Antibody (NBP1-81319).

Blogs on MED19

There are no specific blogs for MED19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED19 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MED19