MED19 Antibody

Images

 
Western Blot: MED19 Antibody [NBP1-81319] - Analysis in human cell line TD47D.
Immunocytochemistry/ Immunofluorescence: MED19 Antibody [NBP1-81319] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED19 Protein (NBP1-81319PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED19 Antibody

  • LCMR1mediator of RNA polymerase II transcription subunit 19
  • Lung cancer metastasis-related protein 1
  • mediator complex subunit 19DT2P1G7
  • mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 19 homolog

Background

MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activatetranscription via RNA polymerase II (Sato et al., 2003 (PubMed 12584197)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13045
Species: Hu
Applications: ICC/IF, WB
NBP2-62629
Species: Hu
Applications: IHC, IHC-P
NBP2-86684
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NBP3-13814
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-84177
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45780
Species: Hu
Applications: IHC, IHC-P, WB
H00055588-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-496
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00010001-D01P
Species: Hu, Mu
Applications: WB
DCMP0
Species: Hu
Applications: ELISA
NBP1-85104
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001299-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-99960
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-83187
Species: Hu
Applications: ChIP, WB
NBP2-92609
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB

Publications for MED19 Antibody (NBP1-81319) (0)

There are no publications for MED19 Antibody (NBP1-81319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED19 Antibody (NBP1-81319) (0)

There are no reviews for MED19 Antibody (NBP1-81319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED19 Antibody (NBP1-81319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED19 Products

Bioinformatics Tool for MED19 Antibody (NBP1-81319)

Discover related pathways, diseases and genes to MED19 Antibody (NBP1-81319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED19 Antibody (NBP1-81319)

Discover more about diseases related to MED19 Antibody (NBP1-81319).
 

Pathways for MED19 Antibody (NBP1-81319)

View related products by pathway.

PTMs for MED19 Antibody (NBP1-81319)

Learn more about PTMs related to MED19 Antibody (NBP1-81319).

Blogs on MED19

There are no specific blogs for MED19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED19