MED15 Antibody - Azide and BSA Free

Western Blot: MED15 Antibody [NBP3-15565] - Western blot analysis of extracts of various cell lines, using MED15 antibody (NBP3-15565) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: MED15 Antibody - Azide and BSA Free [NBP3-15565] - Immunofluorescence analysis of C6 cells using MED15 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MED15 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MED15 Antibody - Azide and BSA Free (NBP3-15565) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MED15 (NP_001003891.1). MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MED15 Antibody - Azide and BSA Free

• ARC105Arc105
• CAG7A
• CTG repeat protein 7a
• CTG7A
• FLJ42282
• FLJ42935
• mediator complex subunit 15PC2 glutamine/Q-rich-associated protein
• mediator of RNA polymerase II transcription subunit 15
• PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein
• PC2-glutamine-rich-associated protein
• PCQAPDKFZp686A2214
• Positive cofactor 2 glutamine/Q-rich-associated protein
• positive cofactor 2, glutamine/Q-rich-associated protein
• TIG1DKFZp762B1216
• TIG-1TPA-inducible gene 1 protein
• TNRC7
• TPA inducible gene-1
• TPA inducible protein
• trinucleotide repeat containing 7,105-kD
• Trinucleotide repeat-containing gene 7 protein

Background

MED15 is encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MED15