MED13 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MED13 Antibody [NBP2-57545] - Staining of human cell line MCF7 shows localization to nucleus. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MED13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MED13 Antibody - BSA Free (NBP2-57545) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MED13 Recombinant Protein Antigen (NBP2-57545PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MED13 Antibody - BSA Free

• Activator-recruited cofactor 250 kDa component
• KIAA0593HSPC221
• mediator complex subunit 13ARC250
• mediator of RNA polymerase II transcription, subunit 13 homolog
• THRAP1mediator of RNA polymerase II transcription subunit 13
• thyroid hormone receptor associated protein 1
• Thyroid hormone receptor-associated protein 1
• Thyroid hormone receptor-associated protein complex 240 kDa component
• thyroid hormone receptor-associated protein complex component TRAP240
• thyroid hormone receptor-associated protein, 240 kDa subunit
• Trap240
• TRAP240DRIP250
• Vitamin D3 receptor-interacting protein complex component DRIP250

Background

MED13 encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. The product of this gene is proposed to form a sub-complex with MED12, cyclin C, and CDK8 that can negatively regulate transactivation by mediator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED13