MED13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED13 Antibody [NBP2-57545] - Staining of human cell line MCF7 shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
Specificity
Specificity of human MED13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED13
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED13 Recombinant Protein Antigen (NBP2-57545PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MED13 Antibody

  • Activator-recruited cofactor 250 kDa component
  • KIAA0593HSPC221
  • mediator complex subunit 13ARC250
  • mediator of RNA polymerase II transcription, subunit 13 homolog
  • THRAP1mediator of RNA polymerase II transcription subunit 13
  • thyroid hormone receptor associated protein 1
  • Thyroid hormone receptor-associated protein 1
  • Thyroid hormone receptor-associated protein complex 240 kDa component
  • thyroid hormone receptor-associated protein complex component TRAP240
  • thyroid hormone receptor-associated protein, 240 kDa subunit
  • Trap240
  • TRAP240DRIP250
  • Vitamin D3 receptor-interacting protein complex component DRIP250

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP2-92902
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
MAB72891
Species: Hu
Applications: WB
NBP1-86185
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NB200-337
Species: Hu, Mu
Applications: WB (-), ChIP, IP
NBP2-61772
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-05523
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-84177
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
NBP2-92796
Species: Hu, Mu
Applications: WB, IHC
NBP1-81122
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004891-M01
Species: Hu, Mu, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-57545
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for MED13 Antibody (NBP2-57545) (0)

There are no publications for MED13 Antibody (NBP2-57545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED13 Antibody (NBP2-57545) (0)

There are no reviews for MED13 Antibody (NBP2-57545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED13 Antibody (NBP2-57545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED13 Products

Array NBP2-57545

Bioinformatics Tool for MED13 Antibody (NBP2-57545)

Discover related pathways, diseases and genes to MED13 Antibody (NBP2-57545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED13 Antibody (NBP2-57545)

Discover more about diseases related to MED13 Antibody (NBP2-57545).
 

Pathways for MED13 Antibody (NBP2-57545)

View related products by pathway.

PTMs for MED13 Antibody (NBP2-57545)

Learn more about PTMs related to MED13 Antibody (NBP2-57545).

Blogs on MED13

There are no specific blogs for MED13, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED13