MeCP2 Recombinant Protein Antigen

Images

 
There are currently no images for MeCP2 Protein (NBP1-81028PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MeCP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MECP2.

Source: E. coli

Amino Acid Sequence: MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAGAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MECP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81028.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MeCP2 Recombinant Protein Antigen

  • AUTSX3
  • DKFZp686A24160
  • MeCp-2 protein
  • mental retardation, X-linked 79
  • methyl CpG binding protein 2 (Rett syndrome)
  • X-linked 16

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DBD00
Species: Hu
Applications: ELISA
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-92242
Species: Hu, Mu, Rt
Applications: WB
NBP1-84881
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56537
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP3-27690
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP3-16718
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for MeCP2 Protein (NBP1-81028PEP) (0)

There are no publications for MeCP2 Protein (NBP1-81028PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MeCP2 Protein (NBP1-81028PEP) (0)

There are no reviews for MeCP2 Protein (NBP1-81028PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MeCP2 Protein (NBP1-81028PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MeCP2 Products

Research Areas for MeCP2 Protein (NBP1-81028PEP)

Find related products by research area.

Blogs on MeCP2.

New MECP2 Study Suggests Important Link to GABA
MECP2 antibodies are used in DNA methylation studies as well as research into Rett syndrome, a progressive neurological disorder caused by a mutation in the MECP2 gene. Now, a new study has been published by the laboratory where the Rett Syndrome gene...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MeCP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MECP2