Recombinant Human MeCP2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MeCP2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 81-170 of Human MeCP2

Source: Wheat Germ

Amino Acid Sequence: PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MECP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MeCP2 Protein

  • AUTSX3
  • DKFZp686A24160
  • MeCp-2 protein
  • mental retardation, X-linked 79
  • methyl CpG binding protein 2 (Rett syndrome)
  • X-linked 16

Background

MECP2 - methyl CpG binding protein 2 (Rett syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD
Species: Hu, Mu, Rt, Ca, Eq
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NBP1-84881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NB100-56630
Species: Hu
Applications: WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56534
Species: Hu
Applications: WB, ChIP, Flow, IHC-P, ICC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MeCP2 Partial Recombinant Protein (H00004204-Q01) (0)

There are no publications for MeCP2 Partial Recombinant Protein (H00004204-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MeCP2 Partial Recombinant Protein (H00004204-Q01) (0)

There are no reviews for MeCP2 Partial Recombinant Protein (H00004204-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MeCP2 Partial Recombinant Protein (H00004204-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MeCP2 Products

Bioinformatics Tool for MeCP2 Partial Recombinant Protein (H00004204-Q01)

Discover related pathways, diseases and genes to MeCP2 Partial Recombinant Protein (H00004204-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MeCP2 Partial Recombinant Protein (H00004204-Q01)

Discover more about diseases related to MeCP2 Partial Recombinant Protein (H00004204-Q01).
 

Pathways for MeCP2 Partial Recombinant Protein (H00004204-Q01)

View related products by pathway.

PTMs for MeCP2 Partial Recombinant Protein (H00004204-Q01)

Learn more about PTMs related to MeCP2 Partial Recombinant Protein (H00004204-Q01).
 

Research Areas for MeCP2 Partial Recombinant Protein (H00004204-Q01)

Find related products by research area.

Blogs on MeCP2.

New MECP2 Study Suggests Important Link to GABA
MECP2 antibodies are used in DNA methylation studies as well as research into Rett syndrome, a progressive neurological disorder caused by a mutation in the MECP2 gene. Now, a new study has been published by the laboratory where the Rett Syndrome gene...  Read full blog post.

Customers Who Bought This Also Bought

MeCP2 Antibody
NB100-56326

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MeCP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MECP2