MDG1 Antibody

Immunohistochemistry-Paraffin: MDG1 Antibody [NBP1-87732] - Staining of human placenta shows positivity in trophoblastic cells.

Immunohistochemistry: MDG1 Antibody [NBP1-87732] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MDG1 Antibody [NBP1-87732] - Staining of human cerebral cortex shows positivity in neurons.

Immunohistochemistry-Paraffin: MDG1 Antibody [NBP1-87732] - Staining of human kidney shows positivity in cells in tubules.

Immunohistochemistry-Paraffin: MDG1 Antibody [NBP1-87732] - Staining of human pancreas shows positivity in exocrine glandular cells.

Product Discontinued

MDG1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJB9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MDG1 Antibody

• DKFZp564F1862
• DnaJ (Hsp40) homolog, subfamily B, member 9
• dnaJ homolog subfamily B member 9
• endoplasmic reticulum DnaJ homolog 4
• ERdj4
• Mdg-1
• MDG1MSTP049
• Microvascular endothelial differentiation gene 1 protein
• MST049

Background

MDG1 acts as a co-chaperone with an Hsp70 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MDG1 Antibody (NBP1-87732)(1)

Publication using NBP1-87732

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: DNAJB9