MBD6 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit MBD6 Antibody - Azide and BSA Free (NBP3-15957) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 880-980 of human MBD6 (NP_443129.3). PGSRREPGRLALKWGTRGGFNGQMERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MBD6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
101 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.05% Proclin 300 |
| Purity |
Affinity purified |
Alternate Names for MBD6 Antibody - Azide and BSA Free
Background
The MBD6 gene encodes a 1,003 amino acid long, 101 kDA methyl-CpG-binding domain protein 6 that binds to heterochromatin. This gene does not interact with methylated or unmethylated DNA but will interact with genes DUSP1, DUSP12, and ELAVL1. The MBD6 gene has been linked to Rett syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ChIP, ICC/IF, IP, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MBD6 Antibody (NBP3-15957) (0)
There are no publications for MBD6 Antibody (NBP3-15957).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MBD6 Antibody (NBP3-15957) (0)
There are no reviews for MBD6 Antibody (NBP3-15957).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBD6 Antibody (NBP3-15957) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MBD6 Products
Blogs on MBD6