MBD6 Antibody - Azide and BSA Free

Western Blot: MBD6 Antibody [NBP3-15957] - Western blot analysis of extracts of various cell lines, using MBD6 antibody (NBP3-15957) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MBD6 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MBD6 Antibody - Azide and BSA Free (NBP3-15957) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 880-980 of human MBD6 (NP_443129.3). PGSRREPGRLALKWGTRGGFNGQMERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 101 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for MBD6 Antibody - Azide and BSA Free

• methyl-CpG binding domain protein 6
• methyl-CpG-binding domain protein 6
• methyl-CpG-binding protein MBD6

Background

The MBD6 gene encodes a 1,003 amino acid long, 101 kDA methyl-CpG-binding domain protein 6 that binds to heterochromatin. This gene does not interact with methylated or unmethylated DNA but will interact with genes DUSP1, DUSP12, and ELAVL1. The MBD6 gene has been linked to Rett syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MBD6