New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

MBD5 Antibody

Images

 
Western Blot: MBD5 Antibody [H00055777-D01P] - Analysis of MBD5 expression in human liver.
Western Blot: MBD5 Antibody [H00055777-D01P] - Analysis of MBD5 expression in HepG2.
Western Blot: MBD5 Antibody [H00055777-D01P] - Analysis of MBD5 expression in transfected 293T cell line by MBD5 polyclonal antibody.Lane 1: MBD5 transfected lysate(24.30 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MBD5 Antibody Summary

Immunogen
MBD5 (AAH14534.1, 1 a.a. - 229 a.a.) full-length human protein. MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
Specificity
Reacts with methyl-CpG binding domain protein 5.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBD5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MBD5 Antibody

  • KIAA1461
  • methyl-CpG binding domain protein 5
  • methyl-CpG-binding domain protein 5
  • methyl-CpG-binding protein MBD5
  • MRD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90523
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84881
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004948-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP1-81363
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP3-09725
Species: Hu
Applications: WB
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93301
Species: Hu, Mu, Rt
Applications: WB
NBP2-75497
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB

Publications for MBD5 Antibody (H00055777-D01P) (0)

There are no publications for MBD5 Antibody (H00055777-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD5 Antibody (H00055777-D01P) (0)

There are no reviews for MBD5 Antibody (H00055777-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBD5 Antibody (H00055777-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MBD5 Products

Bioinformatics Tool for MBD5 Antibody (H00055777-D01P)

Discover related pathways, diseases and genes to MBD5 Antibody (H00055777-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBD5 Antibody (H00055777-D01P)

Discover more about diseases related to MBD5 Antibody (H00055777-D01P).
 

Pathways for MBD5 Antibody (H00055777-D01P)

View related products by pathway.

PTMs for MBD5 Antibody (H00055777-D01P)

Learn more about PTMs related to MBD5 Antibody (H00055777-D01P).

Blogs on MBD5

There are no specific blogs for MBD5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBD5
Entrez