Recombinant Human MAZ Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MAZ Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 332-440 of Human MAZ

Source: Wheat Germ

Amino Acid Sequence: YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAZ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004150-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAZ Protein

  • MAZI
  • MYC-associated zinc finger protein (purine-binding transcription factor)
  • myc-associated zinc finger protein
  • PUR1
  • Pur-1SAF-2
  • Purine-binding transcription factor
  • serum amyloid A activating factor 1
  • serum amyloid A activating factor 2
  • Transcription factor Zif87
  • ZF87SAF-1
  • Zif87
  • Zinc finger protein 801
  • zinc-finger protein, 87 kilodaltons
  • ZNF801SAF-3

Background

MAZ - MYC-associated zinc finger protein (purine-binding transcription factor)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
7270-IL/CF
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-79881
Species: Hu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP

Publications for MAZ Partial Recombinant Protein (H00004150-Q01)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MAZ Partial Recombinant Protein (H00004150-Q01) (0)

There are no reviews for MAZ Partial Recombinant Protein (H00004150-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAZ Partial Recombinant Protein (H00004150-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MAZ Products

Array H00004150-Q01

Bioinformatics Tool for MAZ Partial Recombinant Protein (H00004150-Q01)

Discover related pathways, diseases and genes to MAZ Partial Recombinant Protein (H00004150-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAZ Partial Recombinant Protein (H00004150-Q01)

Discover more about diseases related to MAZ Partial Recombinant Protein (H00004150-Q01).
 

Pathways for MAZ Partial Recombinant Protein (H00004150-Q01)

View related products by pathway.

PTMs for MAZ Partial Recombinant Protein (H00004150-Q01)

Learn more about PTMs related to MAZ Partial Recombinant Protein (H00004150-Q01).

Blogs on MAZ

There are no specific blogs for MAZ, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAZ Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAZ