Maxi Potassium channel alpha Antibody - BSA Free

Images

 
Western Blot: Maxi Potassium channel alpha Antibody [NBP2-87782] - WB Suggested Anti-KCNMA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

Maxi Potassium channel alpha Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Maxi Potassium channel alpha. Peptide sequence: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNMA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Maxi Potassium channel alpha Antibody - BSA Free

  • bA205K10.1
  • BK channel
  • BKCA alpha subunit
  • BKCA alpha
  • BKTM
  • calcium-activated potassium channel subunit alpha-1
  • DKFZp686K1437
  • hSlo
  • K(VCA)alpha
  • KCa1.1
  • KCNMA
  • KCNMA1
  • Maxi K channel
  • Maxi Potassium channel alpha
  • MaxiK
  • MGC71881
  • potassium large conductance calcium-activated channel, subfamily M, alphamember 1
  • SAKCA
  • Slo homolog
  • SLO
  • Slo1
  • Slo-alpha
  • Slowpoke homolog
  • stretch-activated Kca channel
  • subfamily M subunit alpha-1

Background

Function: Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel also contains binding sites for Ca(2+) and Mg(2+).; Defects in KCNMA1 are the cause of generalized epilepsy and paroxysmal dyskinesia (GEPD). Epilepsy is one of the most common and debilitating neurological disorders. Paroxysmal dyskinesias are neurological disorders characterized by sudden, unpredictable, disabling attacks of involuntary movement often requiring life-long treatment. The coexistence of epilepsy and paroxysmal dyskinesia in the same individual or family is an increasingly recognized phenomenon. Patients manifest absence seizures, generalized tonic-clonic seizures, paroxysmal nonkinesigenic dyskinesia, involuntary dystonic or choreiform movements. Onset is usually in childhood and patients may have seizures only, dyskinesia only, or both.; Enzyme regulation: Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation.; Subcellular location: Membrane, Multi-pass membrane protein.; Tissue specificity: Widely expressed. Except in myocytes, it is almost ubiquitously expressed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33694
Species: Hu
Applications: IHC,  IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NB300-535
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-06542
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF640
Species: Mu
Applications: IHC, WB
NBP2-56583
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-05611
Species: Rt
Applications: ELISA, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-52497
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-05611
Species: Rt
Applications: ELISA, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB

Publications for Maxi Potassium channel alpha Antibody (NBP2-87782) (0)

There are no publications for Maxi Potassium channel alpha Antibody (NBP2-87782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Maxi Potassium channel alpha Antibody (NBP2-87782) (0)

There are no reviews for Maxi Potassium channel alpha Antibody (NBP2-87782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Maxi Potassium channel alpha Antibody (NBP2-87782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Maxi Potassium channel alpha Products

Research Areas for Maxi Potassium channel alpha Antibody (NBP2-87782)

Find related products by research area.

Blogs on Maxi Potassium channel alpha

There are no specific blogs for Maxi Potassium channel alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Maxi Potassium channel alpha Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNMA1