MATK Antibody (2C5) - Azide and BSA Free

Western Blot: MATK Antibody (2C5) [H00004145-M05] - Detection against Immunogen (35.2 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2C5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MATK Antibody (2C5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MATK (NP_647612, 422 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
• Specificity: MATK - megakaryocyte-associated tyrosine kinase (2C5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MATK
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MATK Antibody (2C5) - Azide and BSA Free

• CHK
• Csk-type protein tyrosine kinase
• CTKEC 2.7.10.2
• DKFZp434N1212
• EC 2.7.10
• Hematopoietic consensus tyrosine-lacking kinase
• HHYLTK
• hydroxyaryl-protein kinase
• HYL tyrosine kinase
• HYLCsk-homologous kinase
• HYLTK
• leukocyte carboxyl-terminal src kinase related
• Lsk
• megakaryocyte-associated tyrosine kinase
• megakaryocyte-associated tyrosine-protein kinase
• MGC1708
• MGC2101
• Protein kinase HYL
• tyrosine kinase MATK
• Tyrosine-protein kinase CTK
• tyrosylprotein kinase

Background

The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MATK
• Entrez:
  • 4145(Human)
• Uniprot:
  • NP_647612(Human)