MATH2/NEUROD6 Antibody - BSA Free

Western Blot: MATH2/NEUROD6 Antibody [NBP3-10938] - Western blot analysis of MATH2/NEUROD6 in Transfected 293T as a positive control. Antibody dilution at 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MATH2/NEUROD6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATH2/NEUROD6 (NP_073565). Peptide sequence RSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEUROD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MATH2/NEUROD6 Antibody - BSA Free

• Atoh2
• BHLHA2
• bHLHa2MATH2
• Class A basic helix-loop-helix protein 2
• Math-2
• NeuroD6
• neurogenic differentiation 6
• neurogenic differentiation factor 6
• NEX1M
• Protein atonal homolog 2

Background

NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEUROD6