MATH1 Antibody (2G8)

Images

 
Immunocytochemistry/ Immunofluorescence: MATH1 Antibody (2G8) [H00000474-M07] - Analysis of monoclonal antibody to ATOH1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MATH1 Antibody (2G8) Summary

Immunogen
ATOH1 (NP_005163.1, 266 a.a. - 354 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Specificity
ATOH1 (2G8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATOH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MATH1 Antibody (2G8)

  • ATH1protein atonal homolog 1
  • atonal homolog 1 (Drosophila)
  • BHLHA14
  • bHLHa14Math1
  • Class A basic helix-loop-helix protein 14
  • HATH1
  • Helix-loop-helix protein hATH-1
  • MATH-1

Background

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31318
Species: Mu
Applications: IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
AF2746
Species: Hu, Mu
Applications: WB, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-88349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00058158-B02P
Species: Hu
Applications: WB, ELISA
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for MATH1 Antibody (H00000474-M07) (0)

There are no publications for MATH1 Antibody (H00000474-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MATH1 Antibody (H00000474-M07) (0)

There are no reviews for MATH1 Antibody (H00000474-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MATH1 Antibody (H00000474-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MATH1 Products

Bioinformatics Tool for MATH1 Antibody (H00000474-M07)

Discover related pathways, diseases and genes to MATH1 Antibody (H00000474-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MATH1 Antibody (H00000474-M07)

Discover more about diseases related to MATH1 Antibody (H00000474-M07).
 

Pathways for MATH1 Antibody (H00000474-M07)

View related products by pathway.

PTMs for MATH1 Antibody (H00000474-M07)

Learn more about PTMs related to MATH1 Antibody (H00000474-M07).
 

Research Areas for MATH1 Antibody (H00000474-M07)

Find related products by research area.

Blogs on MATH1

There are no specific blogs for MATH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MATH1 Antibody (2G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATOH1
Entrez
OMIM
Uniprot