MAS1L Antibody

Images

 
Western Blot: MAS1L Antibody [NBP2-85255] - Host: Rabbit. Target Name: MAS1L. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAS1L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAS1L. Peptide sequence: WFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETN
Clonality
Polyclonal
Host
Rabbit
Gene
MAS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAS1L Antibody

  • DJ994E9.2
  • MAS1 Oncogene-Like
  • MAS1L
  • MAS1-Like
  • MAS-L
  • MAS-R
  • mas-related G protein-coupled MRG
  • Mas-Related G-Protein Coupled Receptor MRG
  • MRG
  • MRGMGC119987

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1307
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-98552
Species: Hu
Applications: WB
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-47370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00006399-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-75035
Species: Hu, Mu, Ha(-)
Applications: WB, IHC, KD, Single-Cell Western
NB100-1103
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NBP2-85255
Species: Hu
Applications: WB

Publications for MAS1L Antibody (NBP2-85255) (0)

There are no publications for MAS1L Antibody (NBP2-85255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAS1L Antibody (NBP2-85255) (0)

There are no reviews for MAS1L Antibody (NBP2-85255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAS1L Antibody (NBP2-85255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAS1L Products

Array NBP2-85255

Bioinformatics Tool for MAS1L Antibody (NBP2-85255)

Discover related pathways, diseases and genes to MAS1L Antibody (NBP2-85255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAS1L Antibody (NBP2-85255)

Discover more about diseases related to MAS1L Antibody (NBP2-85255).

Research Areas for MAS1L Antibody (NBP2-85255)

Find related products by research area.

Blogs on MAS1L

There are no specific blogs for MAS1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAS1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAS1L