MARK4 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MARK4. Source: E. coli
Amino Acid Sequence: PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MARK4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83442. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MARK4 Recombinant Protein Antigen
Background
MARK4 contains an N terminal serine/threonine kinase domain, a central ubiquitin associated domain, and a C terminal KA1 associated kinase domain. RT PCR analysis detects upregulated expression of the gene for MARK4 in nearly all clinical hepatocellular carcinoma cells. Northern blot analysis reveals ubiquitous expression of a 3.6kb transcript, with highest expression in testis. Immunofluorescence microscopy demonstrates homogeneous cytoplasmic expression. Colony forming assays show that MARK4 antisense reduces the growth of SNU475 cells. It has been suggested that MARK4 provides a growth advantage to cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: AC
Publications for MARK4 Protein (NBP1-83442PEP) (0)
There are no publications for MARK4 Protein (NBP1-83442PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MARK4 Protein (NBP1-83442PEP) (0)
There are no reviews for MARK4 Protein (NBP1-83442PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MARK4 Protein (NBP1-83442PEP) (0)
Additional MARK4 Products
Research Areas for MARK4 Protein (NBP1-83442PEP)
Find related products by research area.
|
Blogs on MARK4