We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MAP4K1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MAP4K1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-83221PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAP4K1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP4K1.

Source: E. coli

Amino Acid Sequence: LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP4K1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83221.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP4K1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • Hematopoietic progenitor kinase
  • HPK1hematopoietic progenitor kinase 1
  • MAPK/ERK kinase kinase kinase 1
  • MEK kinase kinase 1
  • MEKKK 1
  • mitogen-activated protein kinase kinase kinase kinase 1

Background

The hematopoietic progenitor kinase 1 (HPK1) is a mammalian hematopoiesis-specific Ste20 homologue belonging to the germinal center (GC) kinase family, which contains at least 20 kinases (1). HPK1 is implicated in a variety of signaling systems, including epidermal growth factor, transforming growth factor-beta, erythropoietin, prostaglandin E2, and T cell receptor and B cell receptor stimulation. HPK1 is also involved in Fas ligation-mediated apoptosis, NF-B activation and a highly specific activator of the JNK/SAP signaling pathway (2-5). Phosphorylation of HPK1 on threonine 165, serine 171 and tyrosine 379 is a prerequisite for its enzymatic activation in response to immunoreceptor stimulation (6).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
MAB7474
Species: Hu
Applications: ICC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-02962
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-91988
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-37585
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF4559
Species: Hu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-83221PEP
Species: Hu
Applications: AC

Publications for MAP4K1 Recombinant Protein Antigen (NBP1-83221PEP) (0)

There are no publications for MAP4K1 Recombinant Protein Antigen (NBP1-83221PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K1 Recombinant Protein Antigen (NBP1-83221PEP) (0)

There are no reviews for MAP4K1 Recombinant Protein Antigen (NBP1-83221PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP4K1 Recombinant Protein Antigen (NBP1-83221PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP4K1 Products

Research Areas for MAP4K1 Recombinant Protein Antigen (NBP1-83221PEP)

Find related products by research area.

Blogs on MAP4K1

There are no specific blogs for MAP4K1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAP4K1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K1