MAP4K1 Recombinant Protein Antigen

Product Discontinued

MAP4K1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP4K1.
  
  

  Source: E. coli

  Amino Acid Sequence: LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MAP4K1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83221.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP4K1 Recombinant Protein Antigen

• EC 2.7.11
• EC 2.7.11.1
• Hematopoietic progenitor kinase
• HPK1hematopoietic progenitor kinase 1
• MAPK/ERK kinase kinase kinase 1
• MEK kinase kinase 1
• MEKKK 1
• mitogen-activated protein kinase kinase kinase kinase 1

Background

The hematopoietic progenitor kinase 1 (HPK1) is a mammalian hematopoiesis-specific Ste20 homologue belonging to the germinal center (GC) kinase family, which contains at least 20 kinases (1). HPK1 is implicated in a variety of signaling systems, including epidermal growth factor, transforming growth factor-beta, erythropoietin, prostaglandin E2, and T cell receptor and B cell receptor stimulation. HPK1 is also involved in Fas ligation-mediated apoptosis, NF-B activation and a highly specific activator of the JNK/SAP signaling pathway (2-5). Phosphorylation of HPK1 on threonine 165, serine 171 and tyrosine 379 is a prerequisite for its enzymatic activation in response to immunoreceptor stimulation (6).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MAP4K1