Recombinant Human MAP4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MAP4 Protein [H00004134-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human MAP4 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 99 of Human MAP4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MAP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAP4 GST (N-Term) Protein

  • DKFZp779A1753
  • MAP-4
  • MGC8617
  • microtubule-associated protein 4

Background

The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed, the full-length nature of three of which are supported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02673
Species: Hu, Bt, Bv, Ca, Pm, Pm, Rb
Applications: IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NLS909
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Pm, Pm, Rb
Applications: IHC, IHC-P
MAB5277
Species: Hu
Applications: WB, IHC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-99913
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00064112-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004134-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for MAP4 Recombinant Protein (H00004134-P01) (0)

There are no publications for MAP4 Recombinant Protein (H00004134-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4 Recombinant Protein (H00004134-P01) (0)

There are no reviews for MAP4 Recombinant Protein (H00004134-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP4 Recombinant Protein (H00004134-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MAP4 Products

Bioinformatics Tool for MAP4 Recombinant Protein (H00004134-P01)

Discover related pathways, diseases and genes to MAP4 Recombinant Protein (H00004134-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4 Recombinant Protein (H00004134-P01)

Discover more about diseases related to MAP4 Recombinant Protein (H00004134-P01).
 

Pathways for MAP4 Recombinant Protein (H00004134-P01)

View related products by pathway.

PTMs for MAP4 Recombinant Protein (H00004134-P01)

Learn more about PTMs related to MAP4 Recombinant Protein (H00004134-P01).

Blogs on MAP4

There are no specific blogs for MAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAP2 Antibody
NB300-213

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAP4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4