MAP3K6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAP3K6 Antibody [NBP2-14219] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: MAP3K6 Antibody [NBP2-14219] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP3K6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGA RLGRNHVEELLRCLGAHIHTPNRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP3K6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP3K6 Protein (NBP2-14219PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP3K6 Antibody

  • apoptosis signal regulating kinase 2
  • ASK2MGC20114
  • EC 2.7.11
  • EC 2.7.11.25
  • MAPKKK6MEKK6Apoptosis signal-regulating kinase 2
  • MGC125653
  • mitogen-activated protein kinase kinase kinase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84209
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-52971
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for MAP3K6 Antibody (NBP2-14219) (0)

There are no publications for MAP3K6 Antibody (NBP2-14219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K6 Antibody (NBP2-14219) (0)

There are no reviews for MAP3K6 Antibody (NBP2-14219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAP3K6 Antibody (NBP2-14219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP3K6 Products

Bioinformatics Tool for MAP3K6 Antibody (NBP2-14219)

Discover related pathways, diseases and genes to MAP3K6 Antibody (NBP2-14219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP3K6 Antibody (NBP2-14219)

Discover more about diseases related to MAP3K6 Antibody (NBP2-14219).
 

Pathways for MAP3K6 Antibody (NBP2-14219)

View related products by pathway.

Research Areas for MAP3K6 Antibody (NBP2-14219)

Find related products by research area.

Blogs on MAP3K6

There are no specific blogs for MAP3K6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP3K6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K6