We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MAP1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MAP1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-89575PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOAP1.

Source: E. coli

Amino Acid Sequence: RRRLLESLRGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MOAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89575.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP1 Recombinant Protein Antigen

  • MAP1
  • MAP-1PNMA4Paraneoplastic antigen Ma4
  • modulator of apoptosis 1
  • paraneoplastic antigen like 4

Background

MAP1 is a novel Bax-associating protein, named MAP-1 (Modulator of Apoptosis), mediates caspase-dependent apoptosis in mammalian cells when overexpressed. MAP-1 homodimerizes and associates with the proapoptotic Bax and the prosurvival Bcl-2 and Bcl-X(L) of the Bcl-2 family in vitro and in vivo in mammalian cells. These data suggest that MAP-1 mediates apoptosis through a mechanism that involves binding to Bax.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-82801
Species: Hu
Applications: IHC,  IHC-P
MAB3537
Species: Hu
Applications: WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-81259
Species: Hu
Applications: ICC/IF, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1724
Species: Hu
Applications: IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-89575PEP
Species: Hu
Applications: AC

Publications for MAP1 Protein (NBP1-89575PEP) (0)

There are no publications for MAP1 Protein (NBP1-89575PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP1 Protein (NBP1-89575PEP) (0)

There are no reviews for MAP1 Protein (NBP1-89575PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP1 Protein (NBP1-89575PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP1 Products

Research Areas for MAP1 Protein (NBP1-89575PEP)

Find related products by research area.

Blogs on MAP1.

Role of RASSF1A in Death Receptor-Dependent Apoptosis
Death-receptor apoptosis, or cell death, is essential for cellular growth regulation; its disruption is expressed in a variety of cancers. We at Novus Biologicals are one of the leading antibody suppliersfor apoptosis and cancer research groups, and t...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MOAP1