Mammaglobin B Antibody (2E2) - Azide and BSA Free

Western Blot: Mammaglobin B Antibody (2E2) [H00004246-M07] - Detection against Immunogen (37.3 KDa) .

ELISA: Mammaglobin B Antibody (2E2) [H00004246-M07] - Detection limit for recombinant GST tagged SCGB2A1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Mammaglobin B Antibody (2E2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SCGB2A1 (NP_002398.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SCGB2A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mammaglobin B Antibody (2E2) - Azide and BSA Free

• Lacryglobin
• LIPHC
• lipophilin C
• Lipophilin-C
• LPHC
• mammaglobin 2
• mammaglobin B
• Mammaglobin-2
• MGB2mammaglobin-B
• MGC71973
• Secretoglobin family 2A member 1
• secretoglobin, family 2A, member 1
• UGB3mammaglobin-2

Background

Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of endocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein (estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCGB2A1