Mammaglobin B Antibody (2E2)

Images

 
Western Blot: SCGB2A1 Antibody (2E2.) [H00004246-M07] - Detection against Immunogen (37.3 KDa).
ELISA: SCGB2A1 Antibody (2E2.) [H00004246-M07] - Detection limit for recombinant GST tagged SCGB2A1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mammaglobin B Antibody (2E2) Summary

Immunogen
SCGB2A1 (NP_002398.1, 1 a.a. - 95 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCGB2A1
Purity
>50% SDS-PAGE
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
>50% SDS-PAGE

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mammaglobin B Antibody (2E2)

  • Lacryglobin
  • LIPHC
  • lipophilin C
  • Lipophilin-C
  • LPHC
  • mammaglobin 2
  • mammaglobin B
  • Mammaglobin-2
  • MGB2mammaglobin-B
  • MGC71973
  • Secretoglobin family 2A member 1
  • secretoglobin, family 2A, member 1
  • UGB3mammaglobin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-81304
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-85599
Species: Hu
Applications: WB, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
AF3545
Species: Hu
Applications: WB
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
H00005670-Q01
Species: Hu
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00091074-Q01
Species: Hu
NBP1-58906
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00004246-M07
Species: Hu
Applications: WB, ELISA

Publications for Mammaglobin B Antibody (H00004246-M07) (0)

There are no publications for Mammaglobin B Antibody (H00004246-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mammaglobin B Antibody (H00004246-M07) (0)

There are no reviews for Mammaglobin B Antibody (H00004246-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mammaglobin B Antibody (H00004246-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Mammaglobin B Products

Bioinformatics Tool for Mammaglobin B Antibody (H00004246-M07)

Discover related pathways, diseases and genes to Mammaglobin B Antibody (H00004246-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mammaglobin B Antibody (H00004246-M07)

Discover more about diseases related to Mammaglobin B Antibody (H00004246-M07).
 

Pathways for Mammaglobin B Antibody (H00004246-M07)

View related products by pathway.

Blogs on Mammaglobin B

There are no specific blogs for Mammaglobin B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mammaglobin B Antibody (2E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGB2A1