Recombinant Human MAML2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAML2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 796-894 of Human MAML2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQQR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAML2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAML2 Protein

  • DKFZp686N0150
  • KIAA1819MGC176701
  • MAM2
  • mam-2
  • MAM-3
  • MAM3MLL-MAML2
  • mastermind (Drosophila)-like 2
  • mastermind-like 2 (Drosophila)
  • mastermind-like protein 2

Background

MAML2 - mastermind-like 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-33638
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-45545
Species: Hu
Applications: WB, IHC
AF4079
Species: Hu
Applications: WB, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-2129
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
MAB533
Species: Mu
Applications: WB, Neut
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-59312
Species: Hu
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for MAML2 Partial Recombinant Protein (H00084441-Q01) (0)

There are no publications for MAML2 Partial Recombinant Protein (H00084441-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAML2 Partial Recombinant Protein (H00084441-Q01) (0)

There are no reviews for MAML2 Partial Recombinant Protein (H00084441-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAML2 Partial Recombinant Protein (H00084441-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAML2 Products

Bioinformatics Tool for MAML2 Partial Recombinant Protein (H00084441-Q01)

Discover related pathways, diseases and genes to MAML2 Partial Recombinant Protein (H00084441-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAML2 Partial Recombinant Protein (H00084441-Q01)

Discover more about diseases related to MAML2 Partial Recombinant Protein (H00084441-Q01).
 

Pathways for MAML2 Partial Recombinant Protein (H00084441-Q01)

View related products by pathway.

PTMs for MAML2 Partial Recombinant Protein (H00084441-Q01)

Learn more about PTMs related to MAML2 Partial Recombinant Protein (H00084441-Q01).

Blogs on MAML2

There are no specific blogs for MAML2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAML2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAML2