MAML2 Antibody

Images

 
Western Blot: MAML2 Antibody [NBP3-10453] - Western blot analysis of MAML2 in Mouse Kidney as a positive control. Antibody dilution at 0.2-1 ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAML2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the c terminal region of human MAML2 (XP_486185). Peptide sequence PSPLGANNGNNVATFGAGSAGSSQQLRPNLAHSLSGMSAQRSSTVMITAN
Clonality
Polyclonal
Host
Rabbit
Gene
MAML2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for MAML2 Antibody

  • DKFZp686N0150
  • KIAA1819MGC176701
  • MAM2
  • mam-2
  • MAM-3
  • MAM3MLL-MAML2
  • mastermind (Drosophila)-like 2
  • mastermind-like 2 (Drosophila)
  • mastermind-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-1306
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-86674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-12581
Species: Hu
Applications: IHC, IHC-P, WB
H00008209-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB533
Species: Mu
Applications: Neut, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-98959
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-41305
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for MAML2 Antibody (NBP3-10453) (0)

There are no publications for MAML2 Antibody (NBP3-10453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAML2 Antibody (NBP3-10453) (0)

There are no reviews for MAML2 Antibody (NBP3-10453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAML2 Antibody (NBP3-10453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAML2 Products

Bioinformatics Tool for MAML2 Antibody (NBP3-10453)

Discover related pathways, diseases and genes to MAML2 Antibody (NBP3-10453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAML2 Antibody (NBP3-10453)

Discover more about diseases related to MAML2 Antibody (NBP3-10453).
 

Pathways for MAML2 Antibody (NBP3-10453)

View related products by pathway.

PTMs for MAML2 Antibody (NBP3-10453)

Learn more about PTMs related to MAML2 Antibody (NBP3-10453).

Blogs on MAML2

There are no specific blogs for MAML2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAML2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAML2