Home » MAML1 » MAML1 Proteins » Recombinant Human MAML1 Protein

Recombinant Human MAML1 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human MAML1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 655-754 of Human MAML1

Source: Wheat Germ

Amino Acid Sequence: AEQEKQQFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQS
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAML1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAML1 Protein

  • FLJ53540
  • KIAA0200Mam1
  • Mam-1mastermind homolog
  • mastermind (drosophila)-like 1
  • mastermind-like 1 (Drosophila)
  • mastermind-like protein 1

Background

MAML1 - mastermind-like 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

csl/RBPJK Antibody
AF4079
csl/RBPJK Antibody
(1 Review)
Species: Hu
Applications: WB, ICC
Notch-1 Antibody
(mN1A)
NB100-78486
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Notch-1 Antibody (mN1A) [NB100-78486] - Cell extracts from Jurkat (Lane 1) or mouse thymocytes (Lane 2) were Western Blot analyzed with monoclonal anti-NOTCH1 antibody. The mN1A antibody recognizes both mouse and human 270 kD full-length NOTCH1 and 110-120 kD cleaved NOTCH 1 (NICD).
Immunocytochemistry/Immunofluorescence: Notch-1 Antibody (mN1A) [NB100-78486] - The Notch1 Antibody was tested in HEK293 cells at a 1:50 dilution against Dylight 488 (Green). Actin was counterstained against Phalloidin 568 (Red) and cells were mounted in DAPI Flouromount (Blue).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
CSHL1 Antibody
NBP1-59312
Western Blot: CSHL1 Antibody [NBP1-59312] - Human Placenta lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Hes1(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(5 Publications)
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
C21orf33 Antibody
(1F5)
H00008209-M01
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Recombinant Human
CCL4L1/LAG-1 Protein
NBP2-34929
SDS-Page: Human CCL4L1/LAG-1 Protein [NBP2-34929]
Species: Hu
KAT3B/p300
Antibody (RW105)
NB100-616
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-KAT3B/p300 (RW105) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow (Intracellular): KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(8 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
gamma Sarcoglycan
Antibody
NBP1-59744
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAML2 Antibody
(MAML2/1302)
NBP2-53228
Immunohistochemistry-Paraffin: MAML2 Antibody (MAML2/1302) [NBP2-53228] - Formalin-fixed, paraffin-embedded Human Placenta stained with MAML2 Monoclonal Antibody (MAML2/1302).
Immunohistochemistry-Paraffin: MAML2 Antibody (MAML2/1302) [NBP2-53228] - Formalin-fixed, paraffin-embedded Human Bladder Carcinoma stained with MAML2 Monoclonal Antibody (MAML2/1302).
Immunohistochemistry-Paraffin: MAML2 Antibody (MAML2/1302) [NBP2-53228] - Formalin-fixed, paraffin-embedded Human Colon Carcinoma stained with MAML2 Monoclonal Antibody (MAML2/1302).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Notch-4 Antibody
NB100-93551
Western Blot: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in 1. Jurkat 2. U937 3. WEHI 4. Raw267 cell lysates.
Immunocytochemistry/Immunofluorescence: Notch-4 Antibody [NB100-93551] - Notch-4 antibody (1:500) was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 20x.
Immunohistochemistry-Paraffin: Notch-4 Antibody [NB100-93551] - Analysis of Notch-4 in human intestine.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
CDK8 Antibody (5H4)
H00001024-M03
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in PC-12 (Cat # L012V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in Hela S3 NE (Cat # L013V3).
Species: Hu, Mu, Rt
Applications: WB, ELISA
MEF2C Antibody
(OTI1H5)
NBP2-00493
Western Blot: MEF2C Antibody (1H5) [NBP2-00493] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MEF2C (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MEF2C.
Immunocytochemistry/Immunofluorescence: MEF2C Antibody (1H5) [NBP2-00493] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MEF2C.
Immunohistochemistry-Paraffin: MEF2C Antibody (1H5) [NBP2-00493] - Staining of paraffin-embedded Human Ovary tissue using anti-MEF2C mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Notch-2 Antibody
AF1190
Notch‑2 was detected in perfusion fixed frozen sections of rat brain (choroid plexus) using 5 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Notch‑2 was detected in immersion fixed frozen sections of embryonic rat liver (15 d.p.c.) using 1.7 µg/mL Goat Anti-Rat Notch‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1190) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
MAML3 Antibody
NB100-2129
Western Blot: MAML3 Antibody [NB100-2129] - Detection of Human and Mouse MAML3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MAML3 antibody NB100-2129 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: MAML3 Antibody [NB100-2129] - Sample: FFPE section of human breast carcinoma and mouse teratoma. Antibody: Affinity purified rabbit anti-MAML3 used at a dilution of 1:200 (1ug/ml). Detection: DAB
Western Blot: MAML3 Antibody [NB100-2129] - Western Blot and Immunoprecipitation. Whole cell lysate from HeLa, 293T and mouse NIH3T3 cells. Affinity purified rabbit anti-MAML3 antibody NB100-2129. MAML3 was also immunoprecipitated by rabbit anti-MAML3 NB100-2128.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Notch-3 Antibody
(1G5)
H00004854-M01
ELISA: Notch-3 Antibody (1G5) [H00004854-M01] - Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(9 Publications)
Species: Hu
Applications: WB, ELISA

Publications for MAML1 Partial Recombinant Protein (H00009794-Q01) (0)

There are no publications for MAML1 Partial Recombinant Protein (H00009794-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAML1 Partial Recombinant Protein (H00009794-Q01) (0)

There are no reviews for MAML1 Partial Recombinant Protein (H00009794-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAML1 Partial Recombinant Protein (H00009794-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAML1 Products

Bioinformatics Tool for MAML1 Partial Recombinant Protein (H00009794-Q01)

Discover related pathways, diseases and genes to MAML1 Partial Recombinant Protein (H00009794-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAML1 Partial Recombinant Protein (H00009794-Q01)

Discover more about diseases related to MAML1 Partial Recombinant Protein (H00009794-Q01).
 

Pathways for MAML1 Partial Recombinant Protein (H00009794-Q01)

View related products by pathway.

PTMs for MAML1 Partial Recombinant Protein (H00009794-Q01)

Learn more about PTMs related to MAML1 Partial Recombinant Protein (H00009794-Q01).

Blogs on MAML1

There are no specific blogs for MAML1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAML1 Recombinant Protein Antigen
NBP2-57191PEP
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
c-Myc Antibody
NB600-335
Western Blot: MAML1 Antibody [NBP1-33638] - Sample (30 ug of whole cell lysate) A: HeLa B: HeLa nucleus 7.5% SDS PAGE; antibody diluted at 1:1000.
MAML1 Antibody
NBP1-33638
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
p53 Antibody (PAb 240)
NB200-103

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAML1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MAML1