MAGI2 Antibody

Images

 
Immunohistochemistry-Paraffin: MAGI2 Antibody [NBP1-89261] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGI2 Protein (NBP1-89261PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGI2 Antibody

  • ACVRINP1
  • ACVRIP1
  • AIP1
  • AIP1AIP-1
  • ARIP1
  • atrophin 1 interacting protein 1
  • atrophin-1 interacting protein A
  • Atrophin-1-interacting protein 1
  • Atrophin-1-interacting protein A
  • KIAA0705activin receptor interacting protein 1
  • MAGI2
  • MAGI-2SSCAM
  • membrane associated guanylate kinase, WW and PDZ domain containing 2
  • Membrane-associated guanylate kinase inverted 2
  • membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  • SSCAM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-32665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-17210
Species: Hu
Applications: WB, ICC/IF, IP
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-30081
Species: Hu, Mu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89261
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MAGI2 Antibody (NBP1-89261) (0)

There are no publications for MAGI2 Antibody (NBP1-89261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGI2 Antibody (NBP1-89261) (0)

There are no reviews for MAGI2 Antibody (NBP1-89261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAGI2 Antibody (NBP1-89261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGI2 Products

Bioinformatics Tool for MAGI2 Antibody (NBP1-89261)

Discover related pathways, diseases and genes to MAGI2 Antibody (NBP1-89261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGI2 Antibody (NBP1-89261)

Discover more about diseases related to MAGI2 Antibody (NBP1-89261).
 

Pathways for MAGI2 Antibody (NBP1-89261)

View related products by pathway.

PTMs for MAGI2 Antibody (NBP1-89261)

Learn more about PTMs related to MAGI2 Antibody (NBP1-89261).

Blogs on MAGI2

There are no specific blogs for MAGI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGI2
Entrez