![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human lymph node.](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0007.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human lymph node.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAGEB2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Flow (Intracellular): MAGE 1 Antibody (SPM282) - Azide and BSA Free [NBP2-34754] - An intracellular stain was performed on MG-63 cells with MAGE 1 Antibody [SPM282] NBP2-34754AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647. Image using the Alexa Fluor 647 format of this antibody.](http://images.novusbio.com/images2/MAGE-1-Antibody-(SPM282)---Azide-and-BSA-Free-Flow-(Intracellular)-NBP2-34754-img0003.jpg)
![Flow (Intracellular): MAGE 1 Antibody (SPM282) - Azide and BSA Free [NBP2-34754] - An intracellular stain was performed on U2OS cells with MAGE 1 Antibody [SPM282] NBP2-34754AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647. Image using the Alexa Fluor 647 Azide and BSA Free format of this antibody.](http://images.novusbio.com/images2/MAGE-1-Antibody-(SPM282)---Azide-and-BSA-Free-Flow-(Intracellular)-NBP2-34754-img0004.jpg)
![Immunohistochemistry-Paraffin: MAGE 1 Antibody (SPM282) - Azide and BSA Free [NBP2-34754] - Formalin-paraffin human testis stained with MAGE-1 MAb (SPM282).](http://images.novusbio.com/images2/MAGE-1-Antibody-(SPM282)---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-34754-img0005.jpg)
![Immunofluorescence: MAGEA4 Antibody [NBP2-41318] - Human breast cancer tissue with MAGEA4 antibody at 20 ug/ml.](http://images.novusbio.com/images2/MAGEA4-Antibody-Immunofluorescence-NBP2-41318-img0005.jpg)
![Immunofluorescence: MAGEA4 Antibody [NBP2-41318] - HeLa cells with MAGEA4 antibody at 20 ug/ml.](http://images.novusbio.com/images2/MAGEA4-Antibody-Immunofluorescence-NBP2-41318-img0006.jpg)
![Immunohistochemistry-Paraffin: MAGEA4 Antibody [NBP2-41318] - Human breast tumor with MAGEA4 antibody at 5 ug/mL.](http://images.novusbio.com/images2/MAGEA4-Antibody-Immunohistochemistry-Paraffin-NBP2-41318-img0007.jpg)
![Immunohistochemistry: MAGEB1 Antibody (4E12) [NBP2-45801] - Analysis of Carcinoma of Human bladder tissue.](http://images.novusbio.com/images2/MAGEB1-Antibody-(4E12)-Immunohistochemistry-NBP2-45801-img0001.jpg)
![Western Blot: MAGEB1 Antibody (4E12) [NBP2-45801] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MAGEB1.](http://images.novusbio.com/images2/MAGEB1-Antibody-(4E12)-Western-Blot-NBP2-45801-img0003.jpg)
![Western Blot: MAGEB1 Antibody (4E12) [NBP2-45801] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).](http://images.novusbio.com/images2/MAGEB1-Antibody-(4E12)-Western-Blot-NBP2-45801-img0002.jpg)
![Western Blot: MAGEA6 Antibody [NBP3-05152] - Analysis of extracts of various cell lines, using MAGEA6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit](http://images.novusbio.com/images2/MAGEA6-Antibody-Western-Blot-NBP3-05152-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: MAGEA6 Antibody [NBP3-05152] - Analysis of U2OS cells using MAGEA6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/MAGEA6-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05152-img0001.jpg)
![Western Blot: GAGE1 Antibody [NBP2-54704] - Analysis in human cell line AN3-CA.](http://images.novusbio.com/images2/GAGE1-Antibody-Western-Blot-NBP2-54704-img0003.jpg)
![Immunohistochemistry-Paraffin: GAGE1 Antibody [NBP2-54704] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferious ducts.](http://images.novusbio.com/images2/GAGE1-Antibody-Immunohistochemistry-Paraffin-NBP2-54704-img0004.jpg)
![Immunohistochemistry-Paraffin: GAGE1 Antibody [NBP2-54704] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/images2/GAGE1-Antibody-Immunohistochemistry-Paraffin-NBP2-54704-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0002.jpg)
![Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunohistochemistry-Paraffin-NBP2-67232-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: CTAG1B Antibody (OTI2B6) [NBP1-47714] - Staining of 293T cells transfected by pCMV6-ENTRY CTAG1B(RC213318) using anti-CTAG1B antibody (green, upper left; DAPI/blue, lower left; merged, upper right). 293T cells transfected with empty vector served as a negative control (merged, lower right). (1:100)](http://images.novusbio.com/images2/CTAG1B-Antibody-(OTI2B6)-Immunocytochemistry-Immunofluorescence-NBP1-47714-img0013.jpg)
![Flow Cytometry: CTAG1B Antibody (OTI2B6) [NBP1-47714] - Analysis of living 293T cells transfected with CTAG1B overexpression plasmid (RC213318), Red)/empty vector (Blue) using anti-CTAG1B antibody. Cells incubated with a non-specific antibody (Green) were used as isotype control. (1:100)](http://images.novusbio.com/images2/CTAG1B-Antibody-(OTI2B6)-Flow-Cytometry-NBP1-47714-img0014.jpg)
![Flow Cytometry: CTAG1B Antibody (OTI2B6) [NBP1-47714] - Analysis of living NCI-H1299 cells, using anti-CTAG1B antibody(red), compared to an isotype control (green).(1:100)](http://images.novusbio.com/images2/CTAG1B-Antibody-(OTI2B6)-Flow-Cytometry-NBP1-47714-img0015.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the PE/Cy5 conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control PE-Cy5 (NBP1-43073) (blue histogram) or Anti-Human HLA-ABC PE-Cy5 (purple histogram). Cells in the lymphocyte gate were](http://images.novusbio.com/images2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0014.jpg)
![Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f](http://images.novusbio.com/images2/HLA-ABC-Antibody-(W6-32)-Flow-Cytometry-NB100-64775-img0013.jpg)
![Immunohistochemistry-Frozen: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis of Mouse colon cancer tissue using HLA ABC antibody (W6/32). Primary antibody dilution was 1:100. Sample was incubated with secondary antibody in 1:300 dilution. Image from verified customer review.](http://images.novusbio.com/images2/HLA-ABC-Antibody-(W6-32)-Immunohistochemistry-Frozen-NB100-64775-img0015.jpg)
![Western Blot: GAGE-2A Antibody [NBP1-98298] - Antibody Dilution: 1.0ug/ml Sample Tissue: MDA-MB-435S cell lysate.](http://images.novusbio.com/images2/GAGE-2A-Antibody-Western-Blot-NBP1-98298-img0002.jpg)
![ELISA: HLA B Antibody (2G7B10) [NBP2-61871] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)](http://images.novusbio.com/images2/HLA-B-Antibody-(2G7B10)-ELISA-NBP2-61871-img0001.jpg)
![Flow Cytometry: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of MCF-7 cells using HLA-B mouse mAb (green) and negative control (red).](http://images.novusbio.com/images2/HLA-B-Antibody-(2G7B10)-Flow-Cytometry-NBP2-61871-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of Hela cells using HLA-B mouse mAb. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.](http://images.novusbio.com/images2/HLA-B-Antibody-(2G7B10)-Immunocytochemistry-Immunofluorescence-NBP2-61871-img0003.jpg)
![Western Blot: MAGEA2 Antibody (1H4) [H00004101-M01] - Analysis of MAGEA2 expression in transfected 293T cell line by MAGEA2 monoclonal antibody (M01), clone 1H4.Lane 1: MAGEA2 transfected lysate(35 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/MAGEA2-Antibody-(1H4)-Western-Blot-H00004101-M01-img0005.jpg)
![Sandwich ELISA: MAGEA2 Antibody (1H4) [H00004101-M01] - Detection limit for recombinant GST tagged MAGEA2 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/images2/MAGEA2-Antibody-(1H4)-Sandwich-ELISA-H00004101-M01-img0003.jpg)
![Western Blot: MAGEA2 Antibody (1H4) [H00004101-M01] - MAGEA2 monoclonal antibody (M01), clone 1H4 Analysis of MAGEA2 expression in Jurkat.](http://images.novusbio.com/images2/MAGEA2-Antibody-(1H4)-Western-Blot-H00004101-M01-img0004.jpg)
![Western Blot: MAGEB3 Antibody (5H8) [NBP2-45722] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MAGEB3.](http://images.novusbio.com/images2/MAGEB3-Antibody-(5H8)-Western-Blot-NBP2-45722-img0002.jpg)
![Immunohistochemistry: MAGEB3 Antibody (5H8) [NBP2-45722] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/MAGEB3-Antibody-(5H8)-Immunohistochemistry-NBP2-45722-img0001.jpg)
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.](http://images.novusbio.com/images2/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0005.jpg)
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.](http://images.novusbio.com/images2/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0006.jpg)
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.](http://images.novusbio.com/images2/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0007.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for MAGEB2 Antibody (NBP2-62697)Discover more about diseases related to MAGEB2 Antibody (NBP2-62697).
| Pathways for MAGEB2 Antibody (NBP2-62697)View related products by pathway.
|
PTMs for MAGEB2 Antibody (NBP2-62697)Learn more about PTMs related to MAGEB2 Antibody (NBP2-62697).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAGEB2 |
![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Analysis in human testis and endometrium tissues using Anti-MAGEB2 antibody. Corresponding MAGEB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0001.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Analysis in human testis and endometrium tissues using Anti-MAGEB2 antibody. Corresponding MAGEB2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0002.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0003.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human kidney, liver, lymph node and testis using Anti-MAGEB2 antibody NBP2-62697 (A) shows similar protein distribution across tissues to independent antibody NBP2-62688 (B).](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0004.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human kidney, liver, lymph node and testis using Anti-MAGEB2 antibody NBP2-62697 (A) shows similar protein distribution across tissues to independent antibody NBP2-62688 (B).")
![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human kidney.](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0005.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human liver.](http://images.novusbio.com/fullsize2/MAGEB2-Antibody-Immunohistochemistry-Paraffin-NBP2-62697-img0006.jpg "Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human liver.")
![Western Blot: MAGEA3 Antibody (6D10) [H00004102-M01] - Analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/MAGEA3-Antibody-(6D10)-Western-Blot-H00004102-M01-img0005.jpg)
![Sandwich ELISA: MAGEA3 Antibody (6D10) [H00004102-M01] - Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/MAGEA3-Antibody-(6D10)-Sandwich-ELISA-H00004102-M01-img0004.jpg)
![Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Human tissue (4 um section) stained with anti - Melan A monospecific clonal antibody.](http://images.novusbio.com/images2/Melan-A-MART-1-Antibody-(A19-P)-Immunohistochemistry-Paraffin-NBP1-30151-img0011.jpg)
![Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Confocal microscopy image of human fetal inner ear tisue section stained with Melan-A antibody (green), 1:200 dilution, incubated over night. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/images2/Melan-A-MART-1-Antibody-(A19-P)-Immunohistochemistry-Paraffin-NBP1-30151-img0012.jpg)
![Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.](http://images.novusbio.com/images/PMEL17-SILV-Antibody-(10E5)-Western-Blot-NBP1-47974-img0001.jpg)
![Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.](http://images.novusbio.com/images/PMEL17-SILV-Antibody-(10E5)-Immunohistochemistry-Paraffin-NBP1-47974-img0003.jpg)
![Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.](http://images.novusbio.com/images/PMEL17-SILV-Antibody-(10E5)-Immunohistochemistry-Paraffin-NBP1-47974-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")