MAGEB2 Antibody

Images

 
Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human lymph node.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Analysis in human testis and endometrium tissues using Anti-MAGEB2 antibody. Corresponding MAGEB2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human endometrium shows low expression as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human kidney, liver, lymph node and testis using Anti-MAGEB2 antibody NBP2-62697 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human kidney.
Immunohistochemistry-Paraffin: MAGEB2 Antibody [NBP2-62697] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEB2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MAGEB2 Antibody

  • Cancer/testis antigen 3.2
  • cancer/testis antigen family 3, member 2
  • CT3.2MAGE-B2 antigen
  • DAM6MAGE XP-2 antigen
  • DSS/AHC critical interval MAGE superfamily 6
  • DSS-AHC critical interval MAGE superfamily 6
  • MAGE-XP-2
  • melanoma antigen family B, 2
  • melanoma-associated antigen B2
  • MGC26438

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
NBP2-45801
Species: Ca, Hu, Mu
Applications: IHC, WB
NBP3-05152
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-54704
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PP-H7431-00
Species: Hu
Applications: WB
NBP1-98298
Species: Hu
Applications: WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00004101-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-45722
Species: Hu
Applications: IHC, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-62697
Species: Hu
Applications: IHC, IHC-P

Publications for MAGEB2 Antibody (NBP2-62697) (0)

There are no publications for MAGEB2 Antibody (NBP2-62697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEB2 Antibody (NBP2-62697) (0)

There are no reviews for MAGEB2 Antibody (NBP2-62697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAGEB2 Antibody (NBP2-62697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEB2 Products

Bioinformatics Tool for MAGEB2 Antibody (NBP2-62697)

Discover related pathways, diseases and genes to MAGEB2 Antibody (NBP2-62697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB2 Antibody (NBP2-62697)

Discover more about diseases related to MAGEB2 Antibody (NBP2-62697).
 

Pathways for MAGEB2 Antibody (NBP2-62697)

View related products by pathway.

PTMs for MAGEB2 Antibody (NBP2-62697)

Learn more about PTMs related to MAGEB2 Antibody (NBP2-62697).

Blogs on MAGEB2

There are no specific blogs for MAGEB2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB2