MAGEB1 Antibody

Images

 
Immunohistochemistry: MAGEB1 Antibody [NBP1-85405] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGEB1 Protein (NBP1-85405PEP)
Publications
Read Publication using NBP1-85405.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGEB1 Antibody

  • Cancer/testis antigen 3.1
  • CT3.1cancer/testis antigen family 3, member 1
  • DAM10MAGE-B1 antigen
  • DSS/AHC critical interval MAGE superfamily 10
  • DSS-AHC critical interval MAGE superfamily 10
  • MAGEL1MAGE-XP antigen
  • MAGEXP
  • MAGE-Xp
  • melanoma antigen family B, 1
  • melanoma-associated antigen B1
  • MGC9322

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-45722
Species: Hu
Applications: WB, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
NBP1-85405
Species: Hu
Applications: IHC, IHC-P

Publications for MAGEB1 Antibody (NBP1-85405)(1)

Reviews for MAGEB1 Antibody (NBP1-85405) (0)

There are no reviews for MAGEB1 Antibody (NBP1-85405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAGEB1 Antibody (NBP1-85405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEB1 Products

Bioinformatics Tool for MAGEB1 Antibody (NBP1-85405)

Discover related pathways, diseases and genes to MAGEB1 Antibody (NBP1-85405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB1 Antibody (NBP1-85405)

Discover more about diseases related to MAGEB1 Antibody (NBP1-85405).
 

Pathways for MAGEB1 Antibody (NBP1-85405)

View related products by pathway.

PTMs for MAGEB1 Antibody (NBP1-85405)

Learn more about PTMs related to MAGEB1 Antibody (NBP1-85405).

Blogs on MAGEB1

There are no specific blogs for MAGEB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB1