MAGEB2 Antibody

Images

 
Western Blot: MAGEB2 Antibody [NBP1-56838] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEB2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAGEB2(melanoma antigen family B, 2) The peptide sequence was selected from the N terminal of MAGEB2 (NP_002355). Peptide sequence MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MAGEB2 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-56838.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGEB2 Antibody

  • Cancer/testis antigen 3.2
  • cancer/testis antigen family 3, member 2
  • CT3.2MAGE-B2 antigen
  • DAM6MAGE XP-2 antigen
  • DSS/AHC critical interval MAGE superfamily 6
  • DSS-AHC critical interval MAGE superfamily 6
  • MAGE-XP-2
  • melanoma antigen family B, 2
  • melanoma-associated antigen B2
  • MGC26438

Background

This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-41318
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ICC, IF
NBP2-45801
Species: Hu, Mu, Ca
Applications: WB, IHC
NBP3-05152
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-54704
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP1-98298
Species: Hu
Applications: WB
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00004101-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-45722
Species: Hu
Applications: WB, IHC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56838
Species: Hu
Applications: WB

Publications for MAGEB2 Antibody (NBP1-56838)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-56838 Applications Species
Milutinovic,S. Carcinogenesis 28 (3), 560-571. 2007 [PMID: 17012225]

Reviews for MAGEB2 Antibody (NBP1-56838) (0)

There are no reviews for MAGEB2 Antibody (NBP1-56838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEB2 Antibody (NBP1-56838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAGEB2 Products

Bioinformatics Tool for MAGEB2 Antibody (NBP1-56838)

Discover related pathways, diseases and genes to MAGEB2 Antibody (NBP1-56838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB2 Antibody (NBP1-56838)

Discover more about diseases related to MAGEB2 Antibody (NBP1-56838).
 

Pathways for MAGEB2 Antibody (NBP1-56838)

View related products by pathway.

PTMs for MAGEB2 Antibody (NBP1-56838)

Learn more about PTMs related to MAGEB2 Antibody (NBP1-56838).

Blogs on MAGEB2

There are no specific blogs for MAGEB2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB2
Entrez
Uniprot