MafB Antibody - BSA Free

Western Blot: MafB Antibody [NBP2-87769] - Host: Rabbit. Target Name: MAFB. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

Western Blot: MafB Antibody [NBP2-87769] - WB Suggested Anti-MAFB Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle

Western Blot: MafB Antibody [NBP2-87769] - Host: Rabbit. Target Name: MAFB. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Western Blot: MafB Antibody [NBP2-87769] - Host: Mouse. Target Name: MAFB. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MafB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MafB Antibody - BSA Free (NBP2-87769) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MafB. Peptide Sequence LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL. The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAFB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MafB Antibody - BSA Free

• Kreisler (mouse) maf-related leucine zipper homolog
• Kreisler maf-related leucine zipper homolog
• KRML
• KRMLMAFB/Kreisler basic region/leucine zipper transcription factor
• MafB
• Maf-B
• MGC43127
• transcription factor MafB
• v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
• V-maf musculoaponeurotic fibrosarcoma oncogene homolog B

Background

MAFB is encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAFB