MADD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MADD Antibody [NBP1-85258] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: MADD Antibody [NBP1-85258] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MADD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MADD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MADD Protein (NBP1-85258PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MADD Antibody

  • DENNFLJ36300
  • Differentially expressed in normal and neoplastic cells
  • FLJ35600
  • IG20
  • Insulinoma glucagonoma clone 20
  • insulinoma-glucagonoma protein 20
  • KIAA0358RAB3GEP
  • MAP kinase-activating death domain protein
  • MAP-kinase activating death domain
  • Rab3 GDP/GTP exchange factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MADD Antibody (NBP1-85258) (0)

There are no publications for MADD Antibody (NBP1-85258).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MADD Antibody (NBP1-85258) (0)

There are no reviews for MADD Antibody (NBP1-85258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MADD Antibody (NBP1-85258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MADD Products

Bioinformatics Tool for MADD Antibody (NBP1-85258)

Discover related pathways, diseases and genes to MADD Antibody (NBP1-85258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MADD Antibody (NBP1-85258)

Discover more about diseases related to MADD Antibody (NBP1-85258).
 

Pathways for MADD Antibody (NBP1-85258)

View related products by pathway.

PTMs for MADD Antibody (NBP1-85258)

Learn more about PTMs related to MADD Antibody (NBP1-85258).
 

Research Areas for MADD Antibody (NBP1-85258)

Find related products by research area.

Blogs on MADD

There are no specific blogs for MADD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MADD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MADD