MAdCAM-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MAdCAM-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAdCAM-1
  
  

  Source: E.coli

  Amino Acid Sequence: YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MADCAM1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-18862. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAdCAM-1 Recombinant Protein Antigen

• hMAdCAM-1
• MACAM1
• MAdCAM1
• MAdCAM-1
• mucosal addressin cell adhesion molecule 1
• mucosal addressin cell adhesion molecule-1
• mucosal vascular addressin cell adhesion molecule 1

Background

Mucosal vascular addressin-1 (MAdCAM-1) is a type I transmembrane glycoprotein expressed at high levels on high endothelial venules (HEV) of Peyer's patches and mesenteric lymph nodes, and on flat walled venules within the gut lamina propria. It is also expressed on sinus-lining cells in the spleen. (1-3) The countereceptor or "homing receptor" for MAdCAM-1 is alpha4beta7 integrin (also known as LPAM-1). MAdCAM-1 is also a facultative ligand for CD62L/L-selectin. (4, 5) The monoclonal antibody MECA-367 binds to the first domain of MAdCAM-1 and blocks MAdCAM-1-dependent binding in vitro and lymphocyte homing to Peyer's patch HEV in vivo. (1, 2, 4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MADCAM1