![Western Blot: LZTFL1 Antibody (7F6) [H00054585-M01] - LZTFL1 monoclonal antibody (M01), clone 7F6 Analysis of LZTFL1 expression in HeLa.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-7F6-Western-Blot-H00054585-M01-img0010.jpg "Western Blot: LZTFL1 Antibody (7F6) [H00054585-M01] - LZTFL1 monoclonal antibody (M01), clone 7F6 Analysis of LZTFL1 expression in HeLa.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF, IHC |
| Clone | 7F6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | LZTFL1 (NP_065080, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED |
| Specificity | LZTFL1 (7F6) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LZTFL1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
||
| Control |
|
||
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Publication using H00054585-M01 | Applications | Species |
|---|---|---|
| Seo S, Zhang Q, Bugge K et al. A Novel Protein LZTFL1 Regulates Ciliary Trafficking of the BBSome and Smoothened. PLoS Genet. 2011-11-03 [PMID: 22072986] |
Secondary Antibodies |
Isotype Controls |
Research Areas for LZTFL1 Antibody (H00054585-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: LZTFL1 Antibody (7F6) [H00054585-M01] - Analysis of monoclonal antibody to LZTFL1 on HeLa cell. Antibody concentration 25 ug/ml.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-7F6-Immunocytochemistry-Immunofluorescence-H00054585-M01-img0006.jpg "Immunocytochemistry/Immunofluorescence: LZTFL1 Antibody (7F6) [H00054585-M01] - Analysis of monoclonal antibody to LZTFL1 on HeLa cell. Antibody concentration 25 ug/ml.")
![Immunohistochemistry-Paraffin: LZTFL1 Antibody (7F6) [H00054585-M01] - Analysis of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-7F6-Immunohistochemistry-Paraffin-H00054585-M01-img0008.jpg "Immunohistochemistry-Paraffin: LZTFL1 Antibody (7F6) [H00054585-M01] - Analysis of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.")
![Western Blot: LZTFL1 Antibody (7F6) [H00054585-M01] - Analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M01), clone 7F6.Lane 1: LZTFL1 transfected lysate(34.6 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-7F6-Western-Blot-H00054585-M01-img0011.jpg "Western Blot: LZTFL1 Antibody (7F6) [H00054585-M01] - Analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M01), clone 7F6.Lane 1: LZTFL1 transfected lysate(34.6 KDa).Lane 2: Non-transfected lysate.")
![ELISA: LZTFL1 Antibody (7F6) [H00054585-M01] - Detection limit for recombinant GST tagged LZTFL1 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LZTFL1-Antibody-7F6-ELISA-H00054585-M01-img0012.jpg "ELISA: LZTFL1 Antibody (7F6) [H00054585-M01] - Detection limit for recombinant GST tagged LZTFL1 is approximately 0.1ng/ml as a capture antibody.")
![Immunocytochemistry CCR9 Antibody (112509) [Unconjugated]](https://images.novusbio.com/images2/CCR9_MAB179_Immunocytochemistry__Immunofluorescence_17206.jpg)
![Flow Cytometry CC Chemokine Receptor D6 Antibody (196124) [Unconjugated]](https://images.novusbio.com/images2/D6_MAB1364_Flow_Cytometry_15842.jpg)
![Immunocytochemistry LIMD1 Antibody (919330) [Unconjugated]](https://images.novusbio.com/images2/LIMD1_MAB8494_Immunocytochemistry_16234.jpg)
![Immunohistochemistry LIMD1 Antibody (919330) [Unconjugated]](https://images.novusbio.com/images2/LIMD1_MAB8494_Immunohistochemistry_16235.jpg)
![Western Blot LIMD1 Antibody (919330) [Unconjugated]](https://images.novusbio.com/images2/LIMD1_MAB8494_Western_Blot_16741.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")