Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free

Images

 
Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92981] - Analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at 1:1000 dilution.Secondary ...read more

Order Details


    • Catalog Number
      NBP2-92981
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KDM6B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
Theoretical MW
176 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free

  • EC 1.14.11
  • EC 1.14.11.-
  • JmjC domain-containing protein 3
  • JMJD3
  • JMJD3lysine-specific demethylase 6B
  • jumonji domain containing 3, histone lysine demethylase
  • Jumonji domain-containing protein 3
  • KDM6B
  • KIAA0346jumonji domain containing 3
  • Lysine (K)specific Demethylase 6B
  • Lysine (K)-specific Demethylase 6B
  • Lysine demethylase 6B

Background

JMJD3 is a histone demethylase that specifically demethylates trimethylated and dimethylated 'Lys-27' of histone H3, thereby playing a central role in histone code. JMJD3 is also important for the regulation of posterior development by regulating HOX gene expression. JMJD3 is involved in inflammatory response by participating in macrophage differentiation in case of inflammation by regulating gene expression and macrophage differentiation. It has also been shown to be essential to mammalian epidermal differentiation and is upregulated in prostate cancer.

JMJD3 antibodies are useful tools for epigenetics research and specifically for histone modification studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-80628
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF4767
Species: Hu, Mu
Applications: ICC, WB
NBP2-01066
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB4184
Species: Hu, Mu
Applications: ICC, IP, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-83221
Species: Hu
Applications: IHC,  IHC-P
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92981) (0)

There are no publications for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92981) (0)

There are no reviews for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Products

Research Areas for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody (NBP2-92981)

Find related products by research area.

Blogs on Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3

There are no specific blogs for Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM6B