LYRM4 Antibody

Western Blot: LYRM4 Antibody [NBP1-79672] - Mouse Liver Lysate 1ug/ml Gel Concentration 10-20%

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

LYRM4 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human Lyrm4The immunogen for this antibody is Lyrm4. Peptide sequence VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYRM4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LYRM4 Antibody

• C6orf149LYR motif-containing protein 4
• CGI-203
• chromosome 6 open reading frame 149
• ISD11homolog of yeast Isd11
• LYR motif containing 4
• mitochondrial matrix Nfs1 interacting protein

Background

LYRM4 may be involved in mitochondrial iron-sulfur protein biosynthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LYRM4 Antibody (NBP1-79672)(2)

Publications using NBP1-79672

• Majmudar J D, Feng X et al. 4'-Phosphopantetheine and long acyl chain-dependent interactions are integral to human mitochondrial acyl carrier protein function. Medchemcomm 2019-01-02 [PMID: 30881609] (WB, Human)
• Lim SC, Friemel M, Marum JE. Mutations in LYRM4, encoding iron-sulfur cluster biogenesis factor ISD11, cause deficiency of multiple respiratory chain complexes. Hum Mol Genet 2013-06-28 [PMID: 23814038] (WB, Human)

Review for LYRM4 Antibody (NBP1-79672) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 12/02/2013

Summary

• Application: Western Blot
• Sample Tested: Human liver, human skeletal muscle
• Species: Human
• Lot: QC28344

FAQs for LYRM4 Antibody (NBP1-79672). (Showing 1 - 1 of 1 FAQs).

1. Have you used the LYRM4 Antibody (NBP1-79672) against human liver, and if so does it give a clean band on western blot? At what size?
   • This antibody has been validated in human. The immunogen is 100% similar to mouse, so the staining pattern is the same. You will also see a band of around 11 kDa in human, as this is the predicted size of LYRM4 (UniProt Q9HD34).

Bioinformatics

• Gene Symbol: LYRM4
• Uniprot:
  • NP_958746(Mouse)