LYPLA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining of human urinary bladder shows high expression.

Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining in human urinary bladder and pancreas tissues using anti-LYPLA1 antibody. Corresponding LYPLA1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LYPLA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LYPLA1 Antibody - BSA Free (NBP2-14209) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTTQQKLAGVTALNCWLPLWASFPQGPIGGANRDISILQCHGDCDPLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYPLA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LYPLA1 Protein (NBP2-14209PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LYPLA1 Antibody - BSA Free

• acyl-protein thioesterase-1
• APT1
• APT-1
• EC 3.1.2
• EC 3.1.2.-
• EC 3.1.2.22
• hAPT1
• LPL1
• LPL1acyl-protein thioesterase 1
• LPL-I
• LYPLA1
• Lysophospholipase 1
• Lysophospholipase I
• lysophospholipase ILYSOPLA
• lysophospholipid-specific lysophospholipase
• LysoPLA I

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYPLA1