LYPLA1 Antibody

Images

 
Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYPLA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTTQQKLAGVTALNCWLPLWASFPQGPIGGANRDISILQCHGDCDPLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYPLA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LYPLA1 Protein (NBP2-14209PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYPLA1 Antibody

  • acyl-protein thioesterase-1
  • APT1
  • APT-1
  • EC 3.1.2
  • EC 3.1.2.-
  • hAPT1
  • LPL1acyl-protein thioesterase 1
  • LPL-I
  • Lysophospholipase 1
  • lysophospholipase ILYSOPLA
  • lysophospholipid-specific lysophospholipase
  • LysoPLA I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56653
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82000
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-14209
Species: Hu
Applications: IHC, IHC-P

Publications for LYPLA1 Antibody (NBP2-14209) (0)

There are no publications for LYPLA1 Antibody (NBP2-14209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLA1 Antibody (NBP2-14209) (0)

There are no reviews for LYPLA1 Antibody (NBP2-14209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LYPLA1 Antibody (NBP2-14209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYPLA1 Products

Bioinformatics Tool for LYPLA1 Antibody (NBP2-14209)

Discover related pathways, diseases and genes to LYPLA1 Antibody (NBP2-14209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYPLA1 Antibody (NBP2-14209)

Discover more about diseases related to LYPLA1 Antibody (NBP2-14209).
 

Pathways for LYPLA1 Antibody (NBP2-14209)

View related products by pathway.

PTMs for LYPLA1 Antibody (NBP2-14209)

Learn more about PTMs related to LYPLA1 Antibody (NBP2-14209).
 

Research Areas for LYPLA1 Antibody (NBP2-14209)

Find related products by research area.

Blogs on LYPLA1

There are no specific blogs for LYPLA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYPLA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYPLA1