LYPLA1 Antibody


Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining of human urinary bladder shows high expression.
Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: LYPLA1 Antibody [NBP2-14209] - Staining in human urinary bladder and pancreas tissues using anti-LYPLA1 antibody. Corresponding LYPLA1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

LYPLA1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LTTQQKLAGVTALNCWLPLWASFPQGPIGGANRDISILQCHGDCDPLV
Specificity of human LYPLA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LYPLA1 Protein (NBP2-14209PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LYPLA1 Antibody

  • acyl-protein thioesterase-1
  • APT1
  • APT-1
  • EC 3.1.2
  • EC 3.1.2.-
  • hAPT1
  • LPL1acyl-protein thioesterase 1
  • LPL-I
  • Lysophospholipase 1
  • lysophospholipase ILYSOPLA
  • lysophospholipid-specific lysophospholipase
  • LysoPLA I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: IHC, IHC-P

Publications for LYPLA1 Antibody (NBP2-14209) (0)

There are no publications for LYPLA1 Antibody (NBP2-14209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLA1 Antibody (NBP2-14209) (0)

There are no reviews for LYPLA1 Antibody (NBP2-14209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LYPLA1 Antibody (NBP2-14209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LYPLA1 Products

Bioinformatics Tool for LYPLA1 Antibody (NBP2-14209)

Discover related pathways, diseases and genes to LYPLA1 Antibody (NBP2-14209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYPLA1 Antibody (NBP2-14209)

Discover more about diseases related to LYPLA1 Antibody (NBP2-14209).

Pathways for LYPLA1 Antibody (NBP2-14209)

View related products by pathway.

PTMs for LYPLA1 Antibody (NBP2-14209)

Learn more about PTMs related to LYPLA1 Antibody (NBP2-14209).

Research Areas for LYPLA1 Antibody (NBP2-14209)

Find related products by research area.

Blogs on LYPLA1

There are no specific blogs for LYPLA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LYPLA1 Antibody and receive a gift card or discount.


Gene Symbol LYPLA1