LYPD6 Antibody

Images

 
Western Blot: LYPD6 Antibody [NBP1-70629] - Human Small Intestine, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYPD6 Antibody Summary

Immunogen
Synthetic peptides corresponding to LYPD6(LY6/PLAUR domain containing 6) The peptide sequence was selected from the middle region of LYPD6. Peptide sequence RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYPD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LYPD6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LYPD6 Antibody

  • LY6/PLAUR domain containing 6
  • LYPD6
  • UNQ3023/PRO9821

Background

LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2958
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
640-A3
Species: Mu
NBP1-59168
Species: Hu
Applications: WB
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
AF340
Species: Hu
Applications: WB, IHC, Block
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
615-BMC/CF
Species: Hu
NBP2-27352
Species: Hu
Applications: WB, IHC-P
NBP1-87429
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90523
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00984
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1481
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-70629
Species: Hu
Applications: WB

Publications for LYPD6 Antibody (NBP1-70629) (0)

There are no publications for LYPD6 Antibody (NBP1-70629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPD6 Antibody (NBP1-70629) (0)

There are no reviews for LYPD6 Antibody (NBP1-70629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPD6 Antibody (NBP1-70629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYPD6 Products

LYPD6 NBP1-70629

Bioinformatics Tool for LYPD6 Antibody (NBP1-70629)

Discover related pathways, diseases and genes to LYPD6 Antibody (NBP1-70629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYPD6 Antibody (NBP1-70629)

Discover more about diseases related to LYPD6 Antibody (NBP1-70629).
 

Pathways for LYPD6 Antibody (NBP1-70629)

View related products by pathway.

Blogs on LYPD6

There are no specific blogs for LYPD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYPD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYPD6
Entrez