Novus Biologicals products are now on bio-techne.com

Lyn Antibody

Images

 
Western Blot: Lyn Antibody [NBP1-83072] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Lyn Antibody [NBP1-83072] - Staining of human spleen shows high expression.
Western Blot: Lyn Antibody [NBP1-83072] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Lyn Antibody [NBP1-83072] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lyn Antibody [NBP1-83072] - Staining in human spleen and cerebral cortex tissues using anti-LYN antibody. Corresponding LYN RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Lyn Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lyn Protein (NBP1-83072PEP)
Publications
Read Publication using NBP1-83072.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lyn Antibody

  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ26625
  • Hck-2
  • JTK8
  • Lyn
  • tyrosine-protein kinase Lyn
  • v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
  • v-yes-1
  • Yamaguchi sarcoma viral (v-yes-1) related oncogene homolog

Background

Src is the human homolog of the v-Src gene of the Rous sarcoma virus, also known as avian sarcoma virus or ASV. Src is the first proto-oncogenic non-receptor tyrosine kinase characterized in human. By virtue of common structural motifs, the Src family is composed of nine members in vertebrates, including Src, Yes, Fgr, Frk, Fyn, Lyn, Hck, Lck and Blk. Src-family kinases transduce signals that are involved in the control of a variety of cellular processes, including proliferation, differentiation, motility and adhesion. Src-family kinases contain an amino-terminal cell membrane anchor followed by an SH3 domain and an SH2 domain involved in modular association and activation, respectively. Src-family kinases are normally maintained in an inactive state and can be activated transiently during cellular events such as mitosis. The human Lyn gene maps to chromosome 8q13 and encodes a 505 amino acid protein. Hematopoietic tissues predominantly express Lyn, which influences normal immunoglobulin production and regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB3915
Species: Hu, Mu
Applications: WB
NBP1-78295
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB7500
Species: Hu
Applications: ICC, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-85677
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-67321
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-83072
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for Lyn Antibody (NBP1-83072)(1)

Reviews for Lyn Antibody (NBP1-83072) (0)

There are no reviews for Lyn Antibody (NBP1-83072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lyn Antibody (NBP1-83072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lyn Products

Research Areas for Lyn Antibody (NBP1-83072)

Find related products by research area.

Blogs on Lyn

There are no specific blogs for Lyn, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lyn Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYN