Lyn Antibody

Images

 
Western Blot: Lyn Antibody [NBP1-83072] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Lyn Antibody [NBP1-83072] - Staining of human lymph node shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
Western Blot: Lyn Antibody [NBP1-83072] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lyn Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lyn Protein (NBP1-83072PEP)
Publications
Read Publication using NBP1-83072.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lyn Antibody

  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ26625
  • Hck-2
  • JTK8
  • Lyn
  • tyrosine-protein kinase Lyn
  • v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
  • v-yes-1
  • Yamaguchi sarcoma viral (v-yes-1) related oncogene homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
MAB3915
Species: Hu, Mu
Applications: WB
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB3207
Species: Hu, Mu, Rt
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Lyn Antibody (NBP1-83072)(1)

Reviews for Lyn Antibody (NBP1-83072) (0)

There are no reviews for Lyn Antibody (NBP1-83072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lyn Antibody (NBP1-83072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lyn Products

Bioinformatics Tool for Lyn Antibody (NBP1-83072)

Discover related pathways, diseases and genes to Lyn Antibody (NBP1-83072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lyn Antibody (NBP1-83072)

Discover more about diseases related to Lyn Antibody (NBP1-83072).
 

Pathways for Lyn Antibody (NBP1-83072)

View related products by pathway.

PTMs for Lyn Antibody (NBP1-83072)

Learn more about PTMs related to Lyn Antibody (NBP1-83072).

Blogs on Lyn

There are no specific blogs for Lyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lyn Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYN
Entrez