Lyl1 Antibody

Images

 
Western Blot: Lyl1 Antibody [NBP2-85242] - Host: Rabbit. Target Name: Lyl1. Sample Type: Rat Spleen lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Rt, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lyl1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Lyl1. Peptide sequence: GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
LYL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lyl1 Antibody

  • BHLHA18
  • bHLHa18Class A basic helix-loop-helix protein 18
  • lymphoblastic leukemia derived sequence 1
  • Lymphoblastic leukemia-derived sequence 1
  • protein lyl-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-78626
Species: Hu
Applications: WB, ChIP, Flow, IHC, IHC-P, IP, IF
H00030012-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NBP2-38961
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-47940
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
MAB61161
Species: Hu
Applications: IHC
H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006938-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2046
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
H00004125-D01P
Species: Hu
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-85242
Species: Rt, Mu
Applications: WB

Publications for Lyl1 Antibody (NBP2-85242) (0)

There are no publications for Lyl1 Antibody (NBP2-85242).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lyl1 Antibody (NBP2-85242) (0)

There are no reviews for Lyl1 Antibody (NBP2-85242). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lyl1 Antibody (NBP2-85242) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lyl1 Products

Bioinformatics Tool for Lyl1 Antibody (NBP2-85242)

Discover related pathways, diseases and genes to Lyl1 Antibody (NBP2-85242). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lyl1 Antibody (NBP2-85242)

Discover more about diseases related to Lyl1 Antibody (NBP2-85242).
 

Pathways for Lyl1 Antibody (NBP2-85242)

View related products by pathway.

PTMs for Lyl1 Antibody (NBP2-85242)

Learn more about PTMs related to Lyl1 Antibody (NBP2-85242).

Blogs on Lyl1

There are no specific blogs for Lyl1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lyl1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYL1