Lyl1 Antibody - BSA Free

Western Blot: Lyl1 Antibody [NBP2-85241] - WB Suggested Anti-LYL1 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Lyl1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lyl1 Antibody - BSA Free (NBP2-85241) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Lyl1. Peptide sequence: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Lyl1 Antibody - BSA Free

• BHLHA18
• bHLHa18Class A basic helix-loop-helix protein 18
• lymphoblastic leukemia derived sequence 1
• Lymphoblastic leukemia-derived sequence 1
• protein lyl-1

Background

pCMV-LYL1 Full length

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYL1