We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LYK5 Recombinant Protein Antigen

Images

 
There are currently no images for LYK5 Protein (NBP1-89577PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LYK5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRADA.

Source: E. coli

Amino Acid Sequence: MLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STRADA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89577.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LYK5 Recombinant Protein Antigen

  • LYK5FLJ90524
  • NY-BR-96
  • protein kinase LYK5
  • Serologically defined breast cancer antigen NY-BR-96
  • STE20-like pseudokinase
  • STE20-related adapter protein
  • STE20-related adaptor protein
  • STE20-related kinase adapter protein alpha
  • STE20-related kinase adaptor alpha
  • Stlk
  • STRAD alpha
  • STRADPMSE

Background

The protein encoded by the LYK5 gene contains a STE20-like kinase domain, but lacks several residues that are critical forcatalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex withserine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39,also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has beenshown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcriptvariants encoding different isoforms have been found for this gene. Additional transcript variants have been describedbut their full-length nature is not known. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15658
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-87338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-24680
Species: Bv, Ca, Eq, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-33409
Species: Hu
Applications: ICC/IF, WB
NBP3-35679
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-78028
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-67552
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for LYK5 Protein (NBP1-89577PEP) (0)

There are no publications for LYK5 Protein (NBP1-89577PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYK5 Protein (NBP1-89577PEP) (0)

There are no reviews for LYK5 Protein (NBP1-89577PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LYK5 Protein (NBP1-89577PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LYK5 Products

Research Areas for LYK5 Protein (NBP1-89577PEP)

Find related products by research area.

Blogs on LYK5

There are no specific blogs for LYK5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LYK5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STRADA