Recombinant Human LSP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LSP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 240-338 of Human LSP1

Source: Wheat Germ

Amino Acid Sequence: TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LSP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LSP1 Protein

  • 47 kDa actin binding protein
  • 47 kDa actin-binding protein
  • 52 kDa phosphoprotein
  • F-actin binding and cytoskeleton associated protein
  • leufactin (leukocyte F-actin binding protein)
  • leukocyte-specific protein 1
  • lymphocyte-specific protein 1
  • lymphocyte-specific protein pp52
  • pp52
  • WP34Lymphocyte-specific antigen WP34

Background

This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86676
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45072
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-87850
Species: Hu
Applications: IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00004046-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for LSP1 Partial Recombinant Protein (H00004046-Q01) (0)

There are no publications for LSP1 Partial Recombinant Protein (H00004046-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSP1 Partial Recombinant Protein (H00004046-Q01) (0)

There are no reviews for LSP1 Partial Recombinant Protein (H00004046-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSP1 Partial Recombinant Protein (H00004046-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LSP1 Products

Bioinformatics Tool for LSP1 Partial Recombinant Protein (H00004046-Q01)

Discover related pathways, diseases and genes to LSP1 Partial Recombinant Protein (H00004046-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSP1 Partial Recombinant Protein (H00004046-Q01)

Discover more about diseases related to LSP1 Partial Recombinant Protein (H00004046-Q01).
 

Pathways for LSP1 Partial Recombinant Protein (H00004046-Q01)

View related products by pathway.

PTMs for LSP1 Partial Recombinant Protein (H00004046-Q01)

Learn more about PTMs related to LSP1 Partial Recombinant Protein (H00004046-Q01).

Blogs on LSP1

There are no specific blogs for LSP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LSP1 Antibody
NBP1-74048

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LSP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LSP1