LSG1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LSG1 Antibody [NBP1-83755] - Staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & cytosol.

Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells and germinal center cells.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis using Anti-LSG1 antibody NBP1-83755 (A) shows similar pattern to independent antibody NBP2-32698 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LSG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LSG1 Antibody - BSA Free (NBP1-83755) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LSG1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LSG1 Protein (NBP1-83755PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LSG1 Antibody - BSA Free

• EC 3.6.1
• EC 3.6.1.-
• FLJ11301
• FLJ27294
• hLsg1
• large subunit GTPase 1 homolog (S. cerevisiae)
• large subunit GTPase 1 homolog

Background

The LSG1 gene encodes a protein related to the yeast large subunit GTPase 1. The encoded protein is necessary for cell viability and may localize in the endoplasmic reticulum, nucleus and cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LSG1 Antibody (NBP1-83755)(1)

Publication using NBP1-83755

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: LSG1