LSG1 Antibody

Images

 
Western Blot: LSG1 Antibody [NBP1-83755] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: LSG1 Antibody [NBP1-83755] - Staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: LSG1 Antibody [NBP1-83755] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LSG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LSG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LSG1 Protein (NBP1-83755PEP)
Publications
Read Publication using NBP1-83755.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LSG1 Antibody

  • EC 3.6.1
  • EC 3.6.1.-
  • FLJ11301
  • FLJ27294
  • hLsg1
  • large subunit GTPase 1 homolog (S. cerevisiae)
  • large subunit GTPase 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-98594
Species: Hu
Applications: WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24626
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
H00001847-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-57176
Species: Hu
Applications: WB, ICC/IF, IHC
NBL1-12154
Species: Hu
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBL1-11228
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-83755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LSG1 Antibody (NBP1-83755)(1)

Reviews for LSG1 Antibody (NBP1-83755) (0)

There are no reviews for LSG1 Antibody (NBP1-83755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LSG1 Antibody (NBP1-83755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSG1 Products

Bioinformatics Tool for LSG1 Antibody (NBP1-83755)

Discover related pathways, diseases and genes to LSG1 Antibody (NBP1-83755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSG1 Antibody (NBP1-83755)

Discover more about diseases related to LSG1 Antibody (NBP1-83755).
 

Pathways for LSG1 Antibody (NBP1-83755)

View related products by pathway.

PTMs for LSG1 Antibody (NBP1-83755)

Learn more about PTMs related to LSG1 Antibody (NBP1-83755).

Blogs on LSG1

There are no specific blogs for LSG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LSG1